From 6115cd49f705c2ca48c55e1295d089d91661789b Mon Sep 17 00:00:00 2001 From: Hans-Christoph Steiner Date: Wed, 27 Feb 2019 16:52:20 +0100 Subject: [PATCH] convert all active .yml packages to translatable summaries --- metadata/ai.susi.yml | 1 - metadata/ai.susi/en-US/summary.txt | 1 + metadata/android.nachiketa.ebookdownloader.yml | 1 - metadata/android.nachiketa.ebookdownloader/en-US/summary.txt | 1 + metadata/apps.jizzu.simpletodo.yml | 1 - metadata/apps.jizzu.simpletodo/en-US/summary.txt | 1 + metadata/at.tacticaldevc.panictrigger.yml | 1 - metadata/at.tacticaldevc.panictrigger/en-US/summary.txt | 1 + metadata/cc.echonet.coolmicapp.yml | 1 - metadata/cc.echonet.coolmicapp/en-US/summary.txt | 1 + metadata/chat.rocket.android.yml | 1 - metadata/chat.rocket.android/en-US/summary.txt | 1 + metadata/cl.coders.faketraveler.yml | 1 - metadata/cl.coders.faketraveler/en-US/summary.txt | 1 + metadata/click.dummer.imagesms.yml | 1 - metadata/click.dummer.imagesms/en-US/summary.txt | 1 + metadata/click.dummer.notify_to_jabber.yml | 1 - metadata/click.dummer.notify_to_jabber/en-US/summary.txt | 1 + metadata/click.dummer.yidkey.yml | 1 - metadata/click.dummer.yidkey/en-US/summary.txt | 1 + metadata/com.DartChecker.yml | 1 - metadata/com.DartChecker/en-US/summary.txt | 1 + metadata/com.EthanHeming.NeuralNetworkSimulator.yml | 1 - .../com.EthanHeming.NeuralNetworkSimulator/en-US/summary.txt | 1 + metadata/com.GTP.eveminer.yml | 1 - metadata/com.GTP.eveminer/en-US/summary.txt | 1 + metadata/com.aaronhalbert.nosurfforreddit.yml | 1 - metadata/com.aaronhalbert.nosurfforreddit/en-US/summary.txt | 1 + metadata/com.adityakamble49.dcipher.yml | 1 - metadata/com.adityakamble49.dcipher/en-US/summary.txt | 1 + metadata/com.alaskalinuxuser.rilcontrol.yml | 1 - metadata/com.alaskalinuxuser.rilcontrol/en-US/summary.txt | 1 + metadata/com.android.talkback.yml | 1 - metadata/com.android.talkback/en-US/summary.txt | 1 + metadata/com.anpmech.launcher.yml | 1 - metadata/com.anpmech.launcher/en-US/summary.txt | 1 + metadata/com.artifex.mupdf.mini.app.yml | 1 - metadata/com.artifex.mupdf.mini.app/en-US/summary.txt | 1 + metadata/com.b44t.messenger.yml | 1 - metadata/com.b44t.messenger/en-US/summary.txt | 1 + metadata/com.bernaferrari.changedetection.yml | 1 - metadata/com.bernaferrari.changedetection/en-US/summary.txt | 1 + metadata/com.brucelet.spacetrader.yml | 1 - metadata/com.brucelet.spacetrader/en-US/summary.txt | 1 + metadata/com.coboltforge.dontmind.multivnc.yml | 1 - metadata/com.coboltforge.dontmind.multivnc/en-US/summary.txt | 1 + metadata/com.corvettecole.gotosleep.yml | 1 - metadata/com.corvettecole.gotosleep/en-US/summary.txt | 1 + metadata/com.daniel.mobilepauker2.yml | 1 - metadata/com.daniel.mobilepauker2/en-US/summary.txt | 1 + metadata/com.davidshewitt.admincontrol.yml | 1 - metadata/com.davidshewitt.admincontrol/en-US/summary.txt | 1 + metadata/com.example.forgottenumbrella.cardboardmuseum.yml | 1 - .../en-US/summary.txt | 1 + metadata/com.example.harisont.librery.yml | 1 - metadata/com.example.harisont.librery/en-US/summary.txt | 1 + metadata/com.example.hochi.nextcompanion.yml | 1 - metadata/com.example.hochi.nextcompanion/en-US/summary.txt | 1 + metadata/com.example.trigger.yml | 1 - metadata/com.example.trigger/en-US/summary.txt | 1 + metadata/com.fproject.cryptolitycs.yml | 1 - metadata/com.fproject.cryptolitycs/en-US/summary.txt | 1 + metadata/com.freshollie.monkeyboard.keystoneradio.yml | 1 - .../com.freshollie.monkeyboard.keystoneradio/en-US/summary.txt | 1 + metadata/com.github.axet.filemanager.yml | 1 - metadata/com.github.axet.filemanager/en-US/summary.txt | 1 + metadata/com.github.axet.smsgate.yml | 1 - metadata/com.github.axet.smsgate/en-US/summary.txt | 1 + metadata/com.github.catfriend1.syncthingandroid.yml | 1 - .../com.github.catfriend1.syncthingandroid/en-US/summary.txt | 1 + metadata/com.github.cvzi.screenshottile.yml | 1 - metadata/com.github.cvzi.screenshottile/en-US/summary.txt | 1 + metadata/com.github.gotify.yml | 1 - metadata/com.github.gotify/en-US/summary.txt | 1 + metadata/com.github.moko256.twitlatte.yml | 1 - metadata/com.github.moko256.twitlatte/en-US/summary.txt | 1 + metadata/com.github.postapczuk.lalauncher.yml | 1 - metadata/com.github.postapczuk.lalauncher/en-US/summary.txt | 1 + metadata/com.github.yeriomin.yalpstore.yml | 1 - metadata/com.github.yeriomin.yalpstore/en-US/summary.txt | 1 + metadata/com.gitlab.kreikenbaum.suntime.fdroid.yml | 1 - .../com.gitlab.kreikenbaum.suntime.fdroid/en-US/summary.txt | 1 + metadata/com.gmail.jiwopene.temperature.yml | 1 - metadata/com.gmail.jiwopene.temperature/en-US/summary.txt | 1 + metadata/com.google.android.accessibility.talkback.yml | 1 - .../com.google.android.accessibility.talkback/en-US/summary.txt | 1 + metadata/com.governikus.ausweisapp2.yml | 1 - metadata/com.governikus.ausweisapp2/en-US/summary.txt | 1 + metadata/com.gsnathan.pdfviewer.yml | 1 - metadata/com.gsnathan.pdfviewer/en-US/summary.txt | 1 + metadata/com.halftough.webcomreader.yml | 1 - metadata/com.halftough.webcomreader/en-US/summary.txt | 1 + metadata/com.iatfei.streakalarm.yml | 1 - metadata/com.iatfei.streakalarm/en-US/summary.txt | 1 + metadata/com.iboalali.sysnotifsnooze.yml | 1 - metadata/com.iboalali.sysnotifsnooze/en-US/summary.txt | 1 + metadata/com.indieweb.indigenous.yml | 1 - metadata/com.indieweb.indigenous/en-US/summary.txt | 1 + metadata/com.internalpositioning.find3.find3app.yml | 1 - .../com.internalpositioning.find3.find3app/en-US/summary.txt | 1 + metadata/com.iskrembilen.quasseldroid.yml | 1 - metadata/com.iskrembilen.quasseldroid/en-US/summary.txt | 1 + metadata/com.james.status.yml | 1 - metadata/com.james.status/en-US/summary.txt | 1 + metadata/com.jarsilio.android.drowser.yml | 1 - metadata/com.jarsilio.android.drowser/en-US/summary.txt | 1 + metadata/com.jkcarino.ankieditor.yml | 1 - metadata/com.jkcarino.ankieditor/en-US/summary.txt | 1 + metadata/com.kgurgul.cpuinfo.yml | 1 - metadata/com.kgurgul.cpuinfo/en-US/summary.txt | 1 + metadata/com.lavadip.miniVector.yml | 1 - metadata/com.lavadip.miniVector/en-US/summary.txt | 1 + metadata/com.lesspass.android.yml | 1 - metadata/com.lesspass.android/en-US/summary.txt | 1 + metadata/com.limbo.emu.main.yml | 1 - metadata/com.limbo.emu.main/en-US/summary.txt | 1 + metadata/com.lyonbros.turtl.yml | 1 - metadata/com.lyonbros.turtl/en-US/summary.txt | 1 + metadata/com.mdroid.yml | 1 - metadata/com.mdroid/en-US/summary.txt | 1 + metadata/com.money.manager.ex.yml | 1 - metadata/com.money.manager.ex/en-US/summary.txt | 1 + metadata/com.movim.movim.yml | 1 - metadata/com.movim.movim/en-US/summary.txt | 1 + metadata/com.nephi.getoffyourphone.yml | 1 - metadata/com.nephi.getoffyourphone/en-US/summary.txt | 1 + metadata/com.nicobrailo.pianoli.yml | 1 - metadata/com.nicobrailo.pianoli/en-US/summary.txt | 1 + metadata/com.nikhiljha.lobstersapp.yml | 1 - metadata/com.nikhiljha.lobstersapp/en-US/summary.txt | 1 + metadata/com.noprestige.kanaquiz.yml | 1 - metadata/com.noprestige.kanaquiz/en-US/summary.txt | 1 + metadata/com.oF2pks.applicationsinfo.yml | 1 - metadata/com.oF2pks.applicationsinfo/en-US/summary.txt | 1 + metadata/com.oF2pks.classyshark3xodus.yml | 1 - metadata/com.oF2pks.classyshark3xodus/en-US/summary.txt | 1 + metadata/com.oF2pks.kalturadeviceinfos.yml | 1 - metadata/com.oF2pks.kalturadeviceinfos/en-US/summary.txt | 1 + metadata/com.oriondev.moneywallet.yml | 1 - metadata/com.oriondev.moneywallet/en-US/summary.txt | 1 + metadata/com.osfans.trime.yml | 1 - metadata/com.osfans.trime/en-US/summary.txt | 1 + metadata/com.owncloud.android.yml | 1 - metadata/com.owncloud.android/en-US/summary.txt | 1 + metadata/com.quchen.flashcard.yml | 1 - metadata/com.quchen.flashcard/en-US/summary.txt | 1 + metadata/com.rascarlo.adaptive.brightness.tile.yml | 1 - .../com.rascarlo.adaptive.brightness.tile/en-US/summary.txt | 1 + metadata/com.sahdeepsingh.Bop.yml | 1 - metadata/com.sahdeepsingh.Bop/en-US/summary.txt | 1 + metadata/com.samarthdesai.repeatme.yml | 1 - metadata/com.samarthdesai.repeatme/en-US/summary.txt | 1 + metadata/com.scraperclub.android.yml | 1 - metadata/com.scraperclub.android/en-US/summary.txt | 1 + metadata/com.sduduzog.slimlauncher.yml | 1 - metadata/com.sduduzog.slimlauncher/en-US/summary.txt | 1 + metadata/com.simonramstedt.yoke.yml | 1 - metadata/com.simonramstedt.yoke/en-US/summary.txt | 1 + metadata/com.sovworks.edslite.yml | 1 - metadata/com.sovworks.edslite/en-US/summary.txt | 1 + metadata/com.stripe1.xmouse.yml | 1 - metadata/com.stripe1.xmouse/en-US/summary.txt | 1 + metadata/com.suyashsrijan.forcedoze.yml | 1 - metadata/com.suyashsrijan.forcedoze/en-US/summary.txt | 1 + metadata/com.tananaev.calculator.yml | 1 - metadata/com.tananaev.calculator/en-US/summary.txt | 1 + metadata/com.thermatk.android.xf.fakegapps.yml | 1 - metadata/com.thermatk.android.xf.fakegapps/en-US/summary.txt | 1 + metadata/com.thirtydegreesray.openhub.yml | 1 - metadata/com.thirtydegreesray.openhub/en-US/summary.txt | 1 + metadata/com.tht.k3pler.yml | 1 - metadata/com.tht.k3pler/en-US/summary.txt | 1 + metadata/com.tobykurien.webmediashare.yml | 1 - metadata/com.tobykurien.webmediashare/en-US/summary.txt | 1 + metadata/com.ulicae.cinelog.yml | 1 - metadata/com.ulicae.cinelog/en-US/summary.txt | 1 + metadata/com.wangdaye.mysplash.yml | 1 - metadata/com.wangdaye.mysplash/en-US/summary.txt | 1 + metadata/com.wownero.wownerujo.yml | 1 - metadata/com.wownero.wownerujo/en-US/summary.txt | 1 + metadata/com.zzzmode.appopsx.yml | 1 - metadata/com.zzzmode.appopsx/en-US/summary.txt | 1 + metadata/community.fairphone.checkup.yml | 1 - metadata/community.fairphone.checkup/en-US/summary.txt | 1 + metadata/community.peers.internetradio.yml | 1 - metadata/community.peers.internetradio/en-US/summary.txt | 1 + metadata/cz.dvratil.fbeventsync.yml | 1 - metadata/cz.dvratil.fbeventsync/en-US/summary.txt | 1 + metadata/cz.harvie.northdog.yml | 1 - metadata/cz.harvie.northdog/en-US/summary.txt | 1 + metadata/d.d.meshenger.yml | 1 - metadata/d.d.meshenger/en-US/summary.txt | 1 + .../de.antonarnold.android.xoverrideheadphonejackdetection.yml | 1 - .../en-US/summary.txt | 1 + metadata/de.binary_kitchen.doorlock_app.yml | 1 - metadata/de.binary_kitchen.doorlock_app/en-US/summary.txt | 1 + metadata/de.blau.android.yml | 1 - metadata/de.blau.android/en-US/summary.txt | 1 + metadata/de.blocklink.pigrid.yml | 1 - metadata/de.blocklink.pigrid/en-US/summary.txt | 1 + metadata/de.c3nav.droid.yml | 1 - metadata/de.c3nav.droid/en-US/summary.txt | 1 + metadata/de.democracydeutschland.app.yml | 1 - metadata/de.democracydeutschland.app/en-US/summary.txt | 1 + metadata/de.digisocken.stop_o_moto.yml | 1 - metadata/de.digisocken.stop_o_moto/en-US/summary.txt | 1 + metadata/de.drhoffmannsoftware.calcvac.yml | 1 - metadata/de.drhoffmannsoftware.calcvac/en-US/summary.txt | 1 + metadata/de.freifunk_karte.freifunk_karte.yml | 1 - metadata/de.freifunk_karte.freifunk_karte/en-US/summary.txt | 1 + metadata/de.fzi.bettyrieckmann.quotingstars.yml | 1 - metadata/de.fzi.bettyrieckmann.quotingstars/en-US/summary.txt | 1 + metadata/de.hu_berlin.eduroam.yml | 1 - metadata/de.hu_berlin.eduroam/en-US/summary.txt | 1 + metadata/de.igloffstein.maik.aRevelation.yml | 1 - metadata/de.igloffstein.maik.aRevelation/en-US/summary.txt | 1 + metadata/de.kromke.andreas.mediascanner.yml | 1 - metadata/de.kromke.andreas.mediascanner/en-US/summary.txt | 1 + metadata/de.kromke.andreas.musictagger.yml | 1 - metadata/de.kromke.andreas.musictagger/en-US/summary.txt | 1 + metadata/de.larcado.sesam.yml | 1 - metadata/de.larcado.sesam/en-US/summary.txt | 1 + metadata/de.markusfisch.android.binaryeye.yml | 1 - metadata/de.markusfisch.android.binaryeye/en-US/summary.txt | 1 + metadata/de.micmun.android.deufeitage.yml | 1 - metadata/de.micmun.android.deufeitage/en-US/summary.txt | 1 + metadata/de.nodomain.tobihille.seniorlauncher.yml | 1 - metadata/de.nodomain.tobihille.seniorlauncher/en-US/summary.txt | 1 + metadata/de.php_tech.piggybudget.yml | 1 - metadata/de.php_tech.piggybudget/en-US/summary.txt | 1 + metadata/de.r4md4c.gamedealz.yml | 1 - metadata/de.r4md4c.gamedealz/en-US/summary.txt | 1 + metadata/de.spiritcroc.darkcroc.substratum.yml | 1 - metadata/de.spiritcroc.darkcroc.substratum/en-US/summary.txt | 1 + metadata/de.spiritcroc.defaultdarktheme_oms.yml | 1 - metadata/de.spiritcroc.defaultdarktheme_oms/en-US/summary.txt | 1 + metadata/de.uwepost.android.deltacam.yml | 1 - metadata/de.uwepost.android.deltacam/en-US/summary.txt | 1 + metadata/deep.ryd.rydplayer.yml | 1 - metadata/deep.ryd.rydplayer/en-US/summary.txt | 1 + metadata/dk.kjeldsen.carwingsflutter.yml | 1 - metadata/dk.kjeldsen.carwingsflutter/en-US/summary.txt | 1 + metadata/dnsfilter.android.yml | 1 - metadata/dnsfilter.android/en-US/summary.txt | 1 + metadata/eu.depau.etchdroid.yml | 1 - metadata/eu.depau.etchdroid/en-US/summary.txt | 1 + metadata/eu.droogers.smsmatrix.yml | 1 - metadata/eu.droogers.smsmatrix/en-US/summary.txt | 1 + metadata/eu.faircode.email.yml | 1 - metadata/eu.faircode.email/en-US/summary.txt | 1 + metadata/eu.faircode.netguard.yml | 1 - metadata/eu.faircode.netguard/en-US/summary.txt | 1 + metadata/eu.faircode.xlua.yml | 1 - metadata/eu.faircode.xlua/en-US/summary.txt | 1 + metadata/eu.halaser.beamctrl.yml | 1 - metadata/eu.halaser.beamctrl/en-US/summary.txt | 1 + metadata/eu.pretix.pretixdroid.yml | 1 - metadata/eu.pretix.pretixdroid/en-US/summary.txt | 1 + metadata/eu.siacs.conversations.legacy.yml | 1 - metadata/eu.siacs.conversations.legacy/en-US/summary.txt | 1 + metadata/eu.siacs.conversations.voicerecorder.yml | 1 - metadata/eu.siacs.conversations.voicerecorder/en-US/summary.txt | 1 + metadata/eu.siacs.conversations.yml | 1 - metadata/eu.siacs.conversations/en-US/summary.txt | 1 + metadata/eu.veldsoft.brainstonz.yml | 1 - metadata/eu.veldsoft.brainstonz/en-US/summary.txt | 1 + metadata/eu.veldsoft.dice.overflow.yml | 1 - metadata/eu.veldsoft.dice.overflow/en-US/summary.txt | 1 + metadata/eu.veldsoft.free.klondike.yml | 1 - metadata/eu.veldsoft.free.klondike/en-US/summary.txt | 1 + metadata/eu.veldsoft.house.of.cards.yml | 1 - metadata/eu.veldsoft.house.of.cards/en-US/summary.txt | 1 + metadata/eu.veldsoft.kechi.yml | 1 - metadata/eu.veldsoft.kechi/en-US/summary.txt | 1 + metadata/eu.veldsoft.tri.peaks.yml | 1 - metadata/eu.veldsoft.tri.peaks/en-US/summary.txt | 1 + metadata/eu.veldsoft.vitosha.poker.odds.yml | 1 - metadata/eu.veldsoft.vitosha.poker.odds/en-US/summary.txt | 1 + metadata/exa.lnx.a.yml | 1 - metadata/exa.lnx.a/en-US/summary.txt | 1 + metadata/fi.kroon.vadret.yml | 1 - metadata/fi.kroon.vadret/en-US/summary.txt | 1 + metadata/fr.bepo.clavierexterne.yml | 1 - metadata/fr.bepo.clavierexterne/en-US/summary.txt | 1 + metadata/fr.rhaz.ipfs.sweet.yml | 1 - metadata/fr.rhaz.ipfs.sweet/en-US/summary.txt | 1 + metadata/fr.ubordeaux.math.paridroid.yml | 1 - metadata/fr.ubordeaux.math.paridroid/en-US/summary.txt | 1 + metadata/fr.witchdoctors.c4ffein.oosfirmwareextractor.yml | 1 - .../en-US/summary.txt | 1 + metadata/friimaind.piholedroid.yml | 1 - metadata/friimaind.piholedroid/en-US/summary.txt | 1 + metadata/github.vatsal.easyweatherdemo.yml | 1 - metadata/github.vatsal.easyweatherdemo/en-US/summary.txt | 1 + metadata/godau.fynn.dsbdirect.yml | 1 - metadata/godau.fynn.dsbdirect/en-US/summary.txt | 1 + metadata/im.quicksy.client.yml | 1 - metadata/im.quicksy.client/en-US/summary.txt | 1 + metadata/im.vector.alpha.yml | 1 - metadata/im.vector.alpha/en-US/summary.txt | 1 + metadata/info.aario.mywifipasswords.yml | 1 - metadata/info.aario.mywifipasswords/en-US/summary.txt | 1 + metadata/info.guardianproject.courier.yml | 1 - metadata/info.guardianproject.courier/en-US/summary.txt | 1 + metadata/info.guardianproject.gilga.yml | 1 - metadata/info.guardianproject.gilga/en-US/summary.txt | 1 + metadata/info.guardianproject.notepadbot.yml | 1 - metadata/info.guardianproject.notepadbot/en-US/summary.txt | 1 + metadata/info.guardianproject.orfox.yml | 1 - metadata/info.guardianproject.orfox/en-US/summary.txt | 1 + metadata/info.guardianproject.pixelknot.yml | 1 - metadata/info.guardianproject.pixelknot/en-US/summary.txt | 1 + metadata/info.metadude.android.bitsundbaeume.schedule.yml | 1 - .../en-US/summary.txt | 1 + metadata/info.metadude.android.congress.schedule.yml | 1 - .../info.metadude.android.congress.schedule/en-US/summary.txt | 1 + metadata/info.tangential.cone.yml | 1 - metadata/info.tangential.cone/en-US/summary.txt | 1 + metadata/info.zamojski.soft.towercollector.yml | 1 - metadata/info.zamojski.soft.towercollector/en-US/summary.txt | 1 + metadata/io.github.deweyreed.clipboardcleaner.yml | 1 - metadata/io.github.deweyreed.clipboardcleaner/en-US/summary.txt | 1 + metadata/io.github.lufte.lona.yml | 1 - metadata/io.github.lufte.lona/en-US/summary.txt | 1 + metadata/io.github.project_travel_mate.yml | 1 - metadata/io.github.project_travel_mate/en-US/summary.txt | 1 + metadata/io.github.subhamtyagi.openinwhatsapp.yml | 1 - metadata/io.github.subhamtyagi.openinwhatsapp/en-US/summary.txt | 1 + metadata/io.github.subhamtyagi.privacyapplock.yml | 1 - metadata/io.github.subhamtyagi.privacyapplock/en-US/summary.txt | 1 + metadata/io.github.tiagoshibata.gpsdclient.yml | 1 - metadata/io.github.tiagoshibata.gpsdclient/en-US/summary.txt | 1 + metadata/io.mainframe.hacs.yml | 1 - metadata/io.mainframe.hacs/en-US/summary.txt | 1 + metadata/it.diab.yml | 1 - metadata/it.diab/en-US/summary.txt | 1 + metadata/joshuatee.wx.yml | 1 - metadata/joshuatee.wx/en-US/summary.txt | 1 + metadata/jp.ddo.hotmist.unicodepad.yml | 1 - metadata/jp.ddo.hotmist.unicodepad/en-US/summary.txt | 1 + metadata/jp.takke.cpustats.yml | 1 - metadata/jp.takke.cpustats/en-US/summary.txt | 1 + metadata/makeinfo.com.getid.yml | 1 - metadata/makeinfo.com.getid/en-US/summary.txt | 1 + metadata/mancioboxblog.altervista.it.volumecontrol.yml | 1 - .../mancioboxblog.altervista.it.volumecontrol/en-US/summary.txt | 1 + metadata/marto.rtl_tcp_andro.yml | 1 - metadata/marto.rtl_tcp_andro/en-US/summary.txt | 1 + metadata/mavonst.app.easylight.yml | 1 - metadata/mavonst.app.easylight/en-US/summary.txt | 1 + metadata/max.music_cyclon.yml | 1 - metadata/max.music_cyclon/en-US/summary.txt | 1 + metadata/mazechazer.android.wottankquiz.yml | 1 - metadata/mazechazer.android.wottankquiz/en-US/summary.txt | 1 + metadata/mbmb5.lumixextendedcontrolapp.yml | 1 - metadata/mbmb5.lumixextendedcontrolapp/en-US/summary.txt | 1 + metadata/me.alexghr.bulkshare.android.app2.yml | 1 - metadata/me.alexghr.bulkshare.android.app2/en-US/summary.txt | 1 + metadata/me.anon.grow.yml | 1 - metadata/me.anon.grow/en-US/summary.txt | 1 + metadata/me.anuraag.grader.yml | 1 - metadata/me.anuraag.grader/en-US/summary.txt | 1 + metadata/me.anuraag.loveactualized.yml | 1 - metadata/me.anuraag.loveactualized/en-US/summary.txt | 1 + metadata/me.blog.korn123.easydiary.yml | 1 - metadata/me.blog.korn123.easydiary/en-US/summary.txt | 1 + metadata/me.bpear.archonpackager.yml | 1 - metadata/me.bpear.archonpackager/en-US/summary.txt | 1 + metadata/me.ccrama.redditslide.yml | 1 - metadata/me.ccrama.redditslide/en-US/summary.txt | 1 + metadata/me.echeung.cdflabs.yml | 1 - metadata/me.echeung.cdflabs/en-US/summary.txt | 1 + metadata/me.echeung.moemoekyun.fdroid.yml | 1 - metadata/me.echeung.moemoekyun.fdroid/en-US/summary.txt | 1 + metadata/me.guillaumin.android.osmtracker.yml | 1 - metadata/me.guillaumin.android.osmtracker/en-US/summary.txt | 1 + metadata/me.hda.urlhda.yml | 1 - metadata/me.hda.urlhda/en-US/summary.txt | 1 + metadata/me.jakelane.wrapperforfacebook.yml | 1 - metadata/me.jakelane.wrapperforfacebook/en-US/summary.txt | 1 + metadata/me.jamesfrost.simpledo.yml | 1 - metadata/me.jamesfrost.simpledo/en-US/summary.txt | 1 + metadata/me.johnmh.boogdroid.yml | 1 - metadata/me.johnmh.boogdroid/en-US/summary.txt | 1 + metadata/me.kuehle.carreport.yml | 1 - metadata/me.kuehle.carreport/en-US/summary.txt | 1 + metadata/me.malladi.dashcricket.yml | 1 - metadata/me.malladi.dashcricket/en-US/summary.txt | 1 + metadata/me.murks.filmchecker.yml | 1 - metadata/me.murks.filmchecker/en-US/summary.txt | 1 + metadata/me.phh.superuser.yml | 1 - metadata/me.phh.superuser/en-US/summary.txt | 1 + metadata/me.sheimi.sgit.yml | 1 - metadata/me.sheimi.sgit/en-US/summary.txt | 1 + metadata/me.shrimadhavuk.numselapp.yml | 1 - metadata/me.shrimadhavuk.numselapp/en-US/summary.txt | 1 + metadata/me.shrimadhavuk.watransmitter.yml | 1 - metadata/me.shrimadhavuk.watransmitter/en-US/summary.txt | 1 + metadata/me.tripsit.tripmobile.yml | 1 - metadata/me.tripsit.tripmobile/en-US/summary.txt | 1 + metadata/me.tsukanov.counter.yml | 1 - metadata/me.tsukanov.counter/en-US/summary.txt | 1 + metadata/me.writeily.yml | 1 - metadata/me.writeily/en-US/summary.txt | 1 + metadata/me.zeeroooo.materialfb.yml | 1 - metadata/me.zeeroooo.materialfb/en-US/summary.txt | 1 + metadata/menion.android.whereyougo.yml | 1 - metadata/menion.android.whereyougo/en-US/summary.txt | 1 + metadata/mixedbit.speechtrainer.yml | 1 - metadata/mixedbit.speechtrainer/en-US/summary.txt | 1 + metadata/mkg20001.net.samremote.yml | 1 - metadata/mkg20001.net.samremote/en-US/summary.txt | 1 + metadata/mobi.boilr.boilr.yml | 1 - metadata/mobi.boilr.boilr/en-US/summary.txt | 1 + metadata/mobi.cyann.nstools.yml | 1 - metadata/mobi.cyann.nstools/en-US/summary.txt | 1 + metadata/mobi.maptrek.yml | 1 - metadata/mobi.maptrek/en-US/summary.txt | 1 + metadata/mobi.omegacentauri.PerApp.yml | 1 - metadata/mobi.omegacentauri.PerApp/en-US/summary.txt | 1 + metadata/mobi.omegacentauri.SendReduced.yml | 1 - metadata/mobi.omegacentauri.SendReduced/en-US/summary.txt | 1 + metadata/moe.feng.nhentai.yml | 1 - metadata/moe.feng.nhentai/en-US/summary.txt | 1 + metadata/moe.martini.midictrl.yml | 1 - metadata/moe.martini.midictrl/en-US/summary.txt | 1 + metadata/moe.minori.pgpclipper.yml | 1 - metadata/moe.minori.pgpclipper/en-US/summary.txt | 1 + metadata/mohammad.adib.roundr.yml | 1 - metadata/mohammad.adib.roundr/en-US/summary.txt | 1 + metadata/monakhv.android.samlib.yml | 1 - metadata/monakhv.android.samlib/en-US/summary.txt | 1 + metadata/mono.hg.yml | 1 - metadata/mono.hg/en-US/summary.txt | 1 + metadata/name.gdr.acastus_photon.yml | 1 - metadata/name.gdr.acastus_photon/en-US/summary.txt | 1 + metadata/namlit.siteswapgenerator.yml | 1 - metadata/namlit.siteswapgenerator/en-US/summary.txt | 1 + metadata/negativedensity.techahashi.yml | 1 - metadata/negativedensity.techahashi/en-US/summary.txt | 1 + metadata/net.asceai.meritous.yml | 1 - metadata/net.asceai.meritous/en-US/summary.txt | 1 + metadata/net.opendasharchive.openarchive.release.yml | 1 - .../net.opendasharchive.openarchive.release/en-US/summary.txt | 1 + metadata/net.pp3345.ykdroid.yml | 1 - metadata/net.pp3345.ykdroid/en-US/summary.txt | 1 + metadata/net.schueller.peertube.yml | 1 - metadata/net.schueller.peertube/en-US/summary.txt | 1 + metadata/net.typeblog.shelter.yml | 1 - metadata/net.typeblog.shelter/en-US/summary.txt | 1 + metadata/nl.devluuk.sleepywifi.yml | 1 - metadata/nl.devluuk.sleepywifi/en-US/summary.txt | 1 + metadata/nl.eventinfra.wifisetup.yml | 1 - metadata/nl.eventinfra.wifisetup/en-US/summary.txt | 1 + metadata/nodomain.freeyourgadget.tpmsmonitor.yml | 1 - metadata/nodomain.freeyourgadget.tpmsmonitor/en-US/summary.txt | 1 + metadata/opencontacts.open.com.opencontacts.yml | 1 - metadata/opencontacts.open.com.opencontacts/en-US/summary.txt | 1 + metadata/org.atai.TessUI.yml | 1 - metadata/org.atai.TessUI/en-US/summary.txt | 1 + metadata/org.blitzortung.android.app.yml | 1 - metadata/org.blitzortung.android.app/en-US/summary.txt | 1 + metadata/org.covolunablu.marswallpaper.yml | 1 - metadata/org.covolunablu.marswallpaper/en-US/summary.txt | 1 + metadata/org.decsync.cc.yml | 1 - metadata/org.decsync.cc/en-US/summary.txt | 1 + metadata/org.decsync.sparss.floss.yml | 1 - metadata/org.decsync.sparss.floss/en-US/summary.txt | 1 + metadata/org.droidtr.deletegapps.yml | 1 - metadata/org.droidtr.deletegapps/en-US/summary.txt | 1 + metadata/org.droidtr.keyboard.yml | 1 - metadata/org.droidtr.keyboard/en-US/summary.txt | 1 + metadata/org.dystopia.email.yml | 1 - metadata/org.dystopia.email/en-US/summary.txt | 1 + metadata/org.elijaxapps.androidxmrigminer.yml | 1 - metadata/org.elijaxapps.androidxmrigminer/en-US/summary.txt | 1 + metadata/org.example.rosary.yml | 1 - metadata/org.example.rosary/en-US/summary.txt | 1 + metadata/org.flyve.mdm.agent.mqtt.yml | 1 - metadata/org.flyve.mdm.agent.mqtt/en-US/summary.txt | 1 + metadata/org.handmadeideas.chordreader.yml | 1 - metadata/org.handmadeideas.chordreader/en-US/summary.txt | 1 + metadata/org.jschwab.openrecipes.yml | 1 - metadata/org.jschwab.openrecipes/en-US/summary.txt | 1 + metadata/org.jwz.xscreensaver.yml | 1 - metadata/org.jwz.xscreensaver/en-US/summary.txt | 1 + metadata/org.kiwix.kiwixcustomwikivoyageeurope.yml | 1 - .../org.kiwix.kiwixcustomwikivoyageeurope/en-US/summary.txt | 1 + metadata/org.legtux.m_316k.fortune.yml | 1 - metadata/org.legtux.m_316k.fortune/en-US/summary.txt | 1 + metadata/org.legtux.m_316k.taptheblacktiles.yml | 1 - metadata/org.legtux.m_316k.taptheblacktiles/en-US/summary.txt | 1 + metadata/org.lenchan139.ncbookmark.yml | 1 - metadata/org.lenchan139.ncbookmark/en-US/summary.txt | 1 + metadata/org.lf_net.pgpunlocker.yml | 1 - metadata/org.lf_net.pgpunlocker/en-US/summary.txt | 1 + metadata/org.liberty.android.fantastischmemo.yml | 1 - metadata/org.liberty.android.fantastischmemo/en-US/summary.txt | 1 + metadata/org.liberty.android.freeotpplus.yml | 1 - metadata/org.liberty.android.freeotpplus/en-US/summary.txt | 1 + metadata/org.libreflix.app.yml | 1 - metadata/org.libreflix.app/en-US/summary.txt | 1 + metadata/org.libreoffice.impressremote.yml | 1 - metadata/org.libreoffice.impressremote/en-US/summary.txt | 1 + metadata/org.ligi.ajsha.yml | 1 - metadata/org.ligi.ajsha/en-US/summary.txt | 1 + metadata/org.ligi.blexplorer.yml | 1 - metadata/org.ligi.blexplorer/en-US/summary.txt | 1 + metadata/org.ligi.etheremote.yml | 1 - metadata/org.ligi.etheremote/en-US/summary.txt | 1 + metadata/org.ligi.fast.yml | 1 - metadata/org.ligi.fast/en-US/summary.txt | 1 + metadata/org.ligi.faster.yml | 1 - metadata/org.ligi.faster/en-US/summary.txt | 1 + metadata/org.ligi.gobandroid_hd.yml | 1 - metadata/org.ligi.gobandroid_hd/en-US/summary.txt | 1 + metadata/org.ligi.ipfsdroid.yml | 1 - metadata/org.ligi.ipfsdroid/en-US/summary.txt | 1 + metadata/org.ligi.materialteatimer.yml | 1 - metadata/org.ligi.materialteatimer/en-US/summary.txt | 1 + metadata/org.ligi.passandroid.yml | 1 - metadata/org.ligi.passandroid/en-US/summary.txt | 1 + metadata/org.ligi.satoshiproof.yml | 1 - metadata/org.ligi.satoshiproof/en-US/summary.txt | 1 + metadata/org.ligi.scr.yml | 1 - metadata/org.ligi.scr/en-US/summary.txt | 1 + metadata/org.ligi.survivalmanual.yml | 1 - metadata/org.ligi.survivalmanual/en-US/summary.txt | 1 + metadata/org.ligi.vaporizercontrol.yml | 1 - metadata/org.ligi.vaporizercontrol/en-US/summary.txt | 1 + metadata/org.linphone.yml | 1 - metadata/org.linphone/en-US/summary.txt | 1 + metadata/org.logicallycreative.movingpolygons.yml | 1 - metadata/org.logicallycreative.movingpolygons/en-US/summary.txt | 1 + metadata/org.lufebe16.pysolfc.yml | 1 - metadata/org.lufebe16.pysolfc/en-US/summary.txt | 1 + metadata/org.lumicall.android.yml | 1 - metadata/org.lumicall.android/en-US/summary.txt | 1 + metadata/org.mcxa.softsound.yml | 1 - metadata/org.mcxa.softsound/en-US/summary.txt | 1 + metadata/org.mozc.android.inputmethod.japanese.yml | 1 - .../org.mozc.android.inputmethod.japanese/en-US/summary.txt | 1 + metadata/org.mupen64plusae.v3.alpha.yml | 1 - metadata/org.mupen64plusae.v3.alpha/en-US/summary.txt | 1 + metadata/org.nitri.opentopo.yml | 1 - metadata/org.nitri.opentopo/en-US/summary.txt | 1 + metadata/org.openobservatory.ooniprobe.yml | 1 - metadata/org.openobservatory.ooniprobe/en-US/summary.txt | 1 + metadata/org.ostrya.presencepublisher.yml | 1 - metadata/org.ostrya.presencepublisher/en-US/summary.txt | 1 + metadata/org.pipoypipagames.towerjumper.yml | 1 - metadata/org.pipoypipagames.towerjumper/en-US/summary.txt | 1 + metadata/org.projectmaxs.main.yml | 1 - metadata/org.projectmaxs.main/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.alarmset.yml | 1 - metadata/org.projectmaxs.module.alarmset/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.bluetooth.yml | 1 - metadata/org.projectmaxs.module.bluetooth/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.bluetoothadmin.yml | 1 - .../org.projectmaxs.module.bluetoothadmin/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.clipboard.yml | 1 - metadata/org.projectmaxs.module.clipboard/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.contactsread.yml | 1 - metadata/org.projectmaxs.module.contactsread/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.fileread.yml | 1 - metadata/org.projectmaxs.module.fileread/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.filewrite.yml | 1 - metadata/org.projectmaxs.module.filewrite/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.locationfine.yml | 1 - metadata/org.projectmaxs.module.locationfine/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.misc.yml | 1 - metadata/org.projectmaxs.module.misc/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.nfc.yml | 1 - metadata/org.projectmaxs.module.nfc/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.notification.yml | 1 - metadata/org.projectmaxs.module.notification/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.phonestateread.yml | 1 - .../org.projectmaxs.module.phonestateread/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.ringermode.yml | 1 - metadata/org.projectmaxs.module.ringermode/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.shell.yml | 1 - metadata/org.projectmaxs.module.shell/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.smsnotify.yml | 1 - metadata/org.projectmaxs.module.smsnotify/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.smsread.yml | 1 - metadata/org.projectmaxs.module.smsread/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.smssend.yml | 1 - metadata/org.projectmaxs.module.smssend/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.smswrite.yml | 1 - metadata/org.projectmaxs.module.smswrite/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.wifiaccess.yml | 1 - metadata/org.projectmaxs.module.wifiaccess/en-US/summary.txt | 1 + metadata/org.projectmaxs.module.wifichange.yml | 1 - metadata/org.projectmaxs.module.wifichange/en-US/summary.txt | 1 + metadata/org.projectmaxs.transport.xmpp.yml | 1 - metadata/org.projectmaxs.transport.xmpp/en-US/summary.txt | 1 + metadata/org.projectvoodoo.otarootkeeper.yml | 1 - metadata/org.projectvoodoo.otarootkeeper/en-US/summary.txt | 1 + metadata/org.projectvoodoo.screentestpatterns.yml | 1 - metadata/org.projectvoodoo.screentestpatterns/en-US/summary.txt | 1 + metadata/org.projectvoodoo.simplecarrieriqdetector.yml | 1 - .../org.projectvoodoo.simplecarrieriqdetector/en-US/summary.txt | 1 + metadata/org.safermobile.intheclear.yml | 1 - metadata/org.safermobile.intheclear/en-US/summary.txt | 1 + metadata/org.sagemath.droid.yml | 1 - metadata/org.sagemath.droid/en-US/summary.txt | 1 + metadata/org.saiditnet.redreader.yml | 1 - metadata/org.saiditnet.redreader/en-US/summary.txt | 1 + metadata/org.sasehash.burgerwp.yml | 1 - metadata/org.sasehash.burgerwp/en-US/summary.txt | 1 + metadata/org.schabi.etherwake.yml | 1 - metadata/org.schabi.etherwake/en-US/summary.txt | 1 + metadata/org.schabi.kiba.yml | 1 - metadata/org.schabi.kiba/en-US/summary.txt | 1 + metadata/org.schabi.newpipe.yml | 1 - metadata/org.schabi.newpipe/en-US/summary.txt | 1 + metadata/org.schabi.nxbookmarks.owncloud.yml | 1 - metadata/org.schabi.nxbookmarks.owncloud/en-US/summary.txt | 1 + metadata/org.schabi.nxbookmarks.yml | 1 - metadata/org.schabi.nxbookmarks/en-US/summary.txt | 1 + metadata/org.schabi.openhitboxstreams.yml | 1 - metadata/org.schabi.openhitboxstreams/en-US/summary.txt | 1 + metadata/org.schabi.stethox.yml | 1 - metadata/org.schabi.stethox/en-US/summary.txt | 1 + metadata/org.schabi.svgredirect.yml | 1 - metadata/org.schabi.svgredirect/en-US/summary.txt | 1 + metadata/org.schabi.terminightor.yml | 1 - metadata/org.schabi.terminightor/en-US/summary.txt | 1 + metadata/org.scid.android.yml | 1 - metadata/org.scid.android/en-US/summary.txt | 1 + metadata/org.scoutant.blokish.yml | 1 - metadata/org.scoutant.blokish/en-US/summary.txt | 1 + metadata/org.scoutant.cc.yml | 1 - metadata/org.scoutant.cc/en-US/summary.txt | 1 + metadata/org.scoutant.rpn.yml | 1 - metadata/org.scoutant.rpn/en-US/summary.txt | 1 + metadata/org.scummvm.scummvm.yml | 1 - metadata/org.scummvm.scummvm/en-US/summary.txt | 1 + metadata/org.seamapdroid.yml | 1 - metadata/org.seamapdroid/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendly2048.yml | 1 - metadata/org.secuso.privacyfriendly2048/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlyactivitytracker.yml | 1 - .../org.secuso.privacyfriendlyactivitytracker/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlyboardgameclock.yml | 1 - .../org.secuso.privacyfriendlyboardgameclock/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlycardgameone.yml | 1 - .../org.secuso.privacyfriendlycardgameone/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlydame.yml | 1 - metadata/org.secuso.privacyfriendlydame/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlydicer.yml | 1 - metadata/org.secuso.privacyfriendlydicer/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlyintervaltimer.yml | 1 - .../org.secuso.privacyfriendlyintervaltimer/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlyludo.yml | 1 - metadata/org.secuso.privacyfriendlyludo/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlymemory.yml | 1 - metadata/org.secuso.privacyfriendlymemory/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlyminesweeper.yml | 1 - .../org.secuso.privacyfriendlyminesweeper/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlynetmonitor.yml | 1 - metadata/org.secuso.privacyfriendlynetmonitor/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlynotes.yml | 1 - metadata/org.secuso.privacyfriendlynotes/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlypaindiary.yml | 1 - metadata/org.secuso.privacyfriendlypaindiary/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlypasswordgenerator.yml | 1 - .../en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlypausinghealthily.yml | 1 - .../en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlypin.yml | 1 - metadata/org.secuso.privacyfriendlypin/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlyrecknoningskills.yml | 1 - .../en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlyruler.yml | 1 - metadata/org.secuso.privacyfriendlyruler/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlysudoku.yml | 1 - metadata/org.secuso.privacyfriendlysudoku/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlytapemeasure.yml | 1 - .../org.secuso.privacyfriendlytapemeasure/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlytodolist.yml | 1 - metadata/org.secuso.privacyfriendlytodolist/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlyweather.yml | 1 - metadata/org.secuso.privacyfriendlyweather/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlywifimanager.yml | 1 - .../org.secuso.privacyfriendlywifimanager/en-US/summary.txt | 1 + metadata/org.secuso.privacyfriendlyyahtzeedicer.yml | 1 - .../org.secuso.privacyfriendlyyahtzeedicer/en-US/summary.txt | 1 + metadata/org.segin.bfinterpreter.yml | 1 - metadata/org.segin.bfinterpreter/en-US/summary.txt | 1 + metadata/org.segin.ttleditor.yml | 1 - metadata/org.segin.ttleditor/en-US/summary.txt | 1 + metadata/org.sensors2.osc.yml | 1 - metadata/org.sensors2.osc/en-US/summary.txt | 1 + metadata/org.sensors2.pd.yml | 1 - metadata/org.sensors2.pd/en-US/summary.txt | 1 + metadata/org.servDroid.web.yml | 1 - metadata/org.servDroid.web/en-US/summary.txt | 1 + metadata/org.servalproject.yml | 1 - metadata/org.servalproject/en-US/summary.txt | 1 + metadata/org.shadowice.flocke.andotp.yml | 1 - metadata/org.shadowice.flocke.andotp/en-US/summary.txt | 1 + metadata/org.shirakumo.ocelot.yml | 1 - metadata/org.shirakumo.ocelot/en-US/summary.txt | 1 + metadata/org.shortcuts.yml | 1 - metadata/org.shortcuts/en-US/summary.txt | 1 + metadata/org.sickstache.yml | 1 - metadata/org.sickstache/en-US/summary.txt | 1 + metadata/org.sipdroid.sipua.yml | 1 - metadata/org.sipdroid.sipua/en-US/summary.txt | 1 + metadata/org.sixgun.ponyexpress.yml | 1 - metadata/org.sixgun.ponyexpress/en-US/summary.txt | 1 + metadata/org.smblott.intentradio.yml | 1 - metadata/org.smblott.intentradio/en-US/summary.txt | 1 + metadata/org.smc.inputmethod.indic.yml | 1 - metadata/org.smc.inputmethod.indic/en-US/summary.txt | 1 + metadata/org.smerty.zooborns.yml | 1 - metadata/org.smerty.zooborns/en-US/summary.txt | 1 + metadata/org.softcatala.traductor.yml | 1 - metadata/org.softcatala.traductor/en-US/summary.txt | 1 + metadata/org.softeg.slartus.forpdaplus.yml | 1 - metadata/org.softeg.slartus.forpdaplus/en-US/summary.txt | 1 + metadata/org.sorz.lab.tinykeepass.yml | 1 - metadata/org.sorz.lab.tinykeepass/en-US/summary.txt | 1 + metadata/org.sparkleshare.android.yml | 1 - metadata/org.sparkleshare.android/en-US/summary.txt | 1 + metadata/org.strawberryforum.pollywog.yml | 1 - metadata/org.strawberryforum.pollywog/en-US/summary.txt | 1 + metadata/org.subsurface.yml | 1 - metadata/org.subsurface/en-US/summary.txt | 1 + metadata/org.sudowars.yml | 1 - metadata/org.sudowars/en-US/summary.txt | 1 + metadata/org.sufficientlysecure.ical.yml | 1 - metadata/org.sufficientlysecure.ical/en-US/summary.txt | 1 + metadata/org.sufficientlysecure.localcalendar.yml | 1 - metadata/org.sufficientlysecure.localcalendar/en-US/summary.txt | 1 + metadata/org.sufficientlysecure.standalonecalendar.yml | 1 - .../org.sufficientlysecure.standalonecalendar/en-US/summary.txt | 1 + metadata/org.sufficientlysecure.termbot.yml | 1 - metadata/org.sufficientlysecure.termbot/en-US/summary.txt | 1 + metadata/org.sufficientlysecure.viewer.fontpack.yml | 1 - .../org.sufficientlysecure.viewer.fontpack/en-US/summary.txt | 1 + metadata/org.sufficientlysecure.viewer.yml | 1 - metadata/org.sufficientlysecure.viewer/en-US/summary.txt | 1 + metadata/org.sugr.gearshift.yml | 1 - metadata/org.sugr.gearshift/en-US/summary.txt | 1 + metadata/org.supertuxkart.stk.yml | 1 - metadata/org.supertuxkart.stk/en-US/summary.txt | 1 + metadata/org.surrel.facebooknotifications.yml | 1 - metadata/org.surrel.facebooknotifications/en-US/summary.txt | 1 + metadata/org.surrel.messengerbypasser.yml | 1 - metadata/org.surrel.messengerbypasser/en-US/summary.txt | 1 + metadata/org.synergy.yml | 1 - metadata/org.synergy/en-US/summary.txt | 1 + metadata/org.systemcall.scores.yml | 1 - metadata/org.systemcall.scores/en-US/summary.txt | 1 + metadata/org.thiolliere.youtubestream.yml | 1 - metadata/org.thiolliere.youtubestream/en-US/summary.txt | 1 + metadata/org.torproject.android.yml | 1 - metadata/org.torproject.android/en-US/summary.txt | 1 + metadata/org.witness.sscphase1.yml | 1 - metadata/org.witness.sscphase1/en-US/summary.txt | 1 + metadata/org.zephyrsoft.sdbviewer.yml | 1 - metadata/org.zephyrsoft.sdbviewer/en-US/summary.txt | 1 + metadata/org.zimmob.zimlx.yml | 1 - metadata/org.zimmob.zimlx/en-US/summary.txt | 1 + metadata/paulscode.android.mupen64plusae.yml | 1 - metadata/paulscode.android.mupen64plusae/en-US/summary.txt | 1 + metadata/pc.javier.seguime.yml | 1 - metadata/pc.javier.seguime/en-US/summary.txt | 2 +- metadata/peanutencryption.peanutencryption.yml | 1 - metadata/peanutencryption.peanutencryption/en-US/summary.txt | 1 + metadata/pk.contender.earmouse.yml | 1 - metadata/pk.contender.earmouse/en-US/summary.txt | 1 + metadata/pl.hypeapp.endoscope.yml | 1 - metadata/pl.hypeapp.endoscope/en-US/summary.txt | 1 + metadata/pl.hypeapp.episodie.yml | 1 - metadata/pl.hypeapp.episodie/en-US/summary.txt | 1 + metadata/pl.kuben.progressapp.yml | 1 - metadata/pl.kuben.progressapp/en-US/summary.txt | 1 + metadata/pl.narfsoftware.thermometer.yml | 1 - metadata/pl.narfsoftware.thermometer/en-US/summary.txt | 1 + metadata/pl.net.szafraniec.NFCKey.yml | 1 - metadata/pl.net.szafraniec.NFCKey/en-US/summary.txt | 1 + metadata/pl.net.szafraniec.NFCTagmaker.yml | 1 - metadata/pl.net.szafraniec.NFCTagmaker/en-US/summary.txt | 1 + metadata/pl.nkg.geokrety.yml | 1 - metadata/pl.nkg.geokrety/en-US/summary.txt | 1 + metadata/pl.sanszo.pcis.yml | 1 - metadata/player.efis.data.eur.rus.yml | 1 - metadata/player.efis.data.eur.rus/en-US/summary.txt | 1 + metadata/player.efis.data.pan.arg.yml | 1 - metadata/player.efis.data.pan.arg/en-US/summary.txt | 1 + metadata/player.efis.data.sah.jap.yml | 1 - metadata/player.efis.data.sah.jap/en-US/summary.txt | 1 + metadata/player.efis.data.usa.can.yml | 1 - metadata/player.efis.data.usa.can/en-US/summary.txt | 1 + metadata/player.efis.data.zar.aus.yml | 1 - metadata/player.efis.data.zar.aus/en-US/summary.txt | 1 + metadata/player.efis.mfd.yml | 1 - metadata/player.efis.mfd/en-US/summary.txt | 1 + metadata/player.efis.pfd.yml | 1 - metadata/player.efis.pfd/en-US/summary.txt | 1 + metadata/press.condense.www.yml | 1 - metadata/press.condense.www/en-US/summary.txt | 1 + metadata/priv.twoerner.brightnesswidget.yml | 1 - metadata/priv.twoerner.brightnesswidget/en-US/summary.txt | 1 + ...endlyshoppinglist.secuso.org.privacyfriendlyshoppinglist.yml | 1 - .../en-US/summary.txt | 1 + metadata/pro.dbro.bart.yml | 1 - metadata/pro.dbro.bart/en-US/summary.txt | 1 + metadata/pro.oneredpixel.l9droid.yml | 1 - metadata/pro.oneredpixel.l9droid/en-US/summary.txt | 1 + metadata/pro.rudloff.openvegemap.yml | 1 - metadata/pro.rudloff.openvegemap/en-US/summary.txt | 1 + metadata/pro.rudloff.papercraft.yml | 1 - metadata/pro.rudloff.papercraft/en-US/summary.txt | 1 + metadata/protect.babymonitor.yml | 1 - metadata/protect.babymonitor/en-US/summary.txt | 1 + metadata/protect.babysleepsounds.yml | 1 - metadata/protect.babysleepsounds/en-US/summary.txt | 1 + metadata/protect.budgetwatch.yml | 1 - metadata/protect.budgetwatch/en-US/summary.txt | 1 + metadata/protect.card_locker.yml | 1 - metadata/protect.card_locker/en-US/summary.txt | 1 + metadata/protect.gift_card_guard.yml | 1 - metadata/protect.gift_card_guard/en-US/summary.txt | 1 + metadata/protect.rentalcalc.yml | 1 - metadata/protect.rentalcalc/en-US/summary.txt | 1 + metadata/protect.videoeditor.yml | 1 - metadata/protect.videoeditor/en-US/summary.txt | 1 + metadata/pt.ipleiria.mymusicqoe.yml | 1 - metadata/pt.ipleiria.mymusicqoe/en-US/summary.txt | 1 + metadata/pt.isec.tp.am.yml | 1 - metadata/pt.isec.tp.am/en-US/summary.txt | 1 + metadata/pt.joaomneto.titancompanion.yml | 1 - metadata/pt.joaomneto.titancompanion/en-US/summary.txt | 1 + metadata/pw.thedrhax.mosmetro.yml | 1 - metadata/pw.thedrhax.mosmetro/en-US/summary.txt | 1 + metadata/raele.concurseiro.yml | 1 - metadata/raele.concurseiro/en-US/summary.txt | 1 + metadata/re.jcg.playmusicexporter.yml | 1 - metadata/re.jcg.playmusicexporter/en-US/summary.txt | 1 + metadata/remuco.client.android.yml | 1 - metadata/remuco.client.android/en-US/summary.txt | 1 + metadata/rino.org.tethercompanion.yml | 1 - metadata/rino.org.tethercompanion/en-US/summary.txt | 1 + metadata/rkr.simplekeyboard.inputmethod.yml | 1 - metadata/rkr.simplekeyboard.inputmethod/en-US/summary.txt | 1 + metadata/ro.ciubex.dscautorename.yml | 1 - metadata/ro.ciubex.dscautorename/en-US/summary.txt | 1 + metadata/ro.ieval.fonbot.yml | 1 - metadata/ro.ieval.fonbot/en-US/summary.txt | 1 + metadata/ro.mihai.tpt.yml | 1 - metadata/ro.mihai.tpt/en-US/summary.txt | 1 + metadata/ro.ui.pttdroid.yml | 1 - metadata/ro.ui.pttdroid/en-US/summary.txt | 1 + metadata/rodrigodavy.com.github.pixelartist.yml | 1 - metadata/rodrigodavy.com.github.pixelartist/en-US/summary.txt | 1 + metadata/rs.pedjaapps.alogcatroot.app.yml | 1 - metadata/rs.pedjaapps.alogcatroot.app/en-US/summary.txt | 1 + metadata/ru.equestriadev.mgke.yml | 1 - metadata/ru.equestriadev.mgke/en-US/summary.txt | 1 + metadata/ru.exlmoto.snood21.yml | 1 - metadata/ru.exlmoto.snood21/en-US/summary.txt | 1 + metadata/ru.gelin.android.browser.open.yml | 1 - metadata/ru.gelin.android.browser.open/en-US/summary.txt | 1 + metadata/ru.gelin.android.sendtosd.yml | 1 - metadata/ru.gelin.android.sendtosd/en-US/summary.txt | 1 + .../ru.gelin.android.weather.notification.skin.biggertext.yml | 1 - .../en-US/summary.txt | 1 + .../ru.gelin.android.weather.notification.skin.blacktext.yml | 1 - .../en-US/summary.txt | 1 + ...ru.gelin.android.weather.notification.skin.blacktextplus.yml | 1 - .../en-US/summary.txt | 1 + .../ru.gelin.android.weather.notification.skin.whitetext.yml | 1 - .../en-US/summary.txt | 1 + ...ru.gelin.android.weather.notification.skin.whitetextplus.yml | 1 - .../en-US/summary.txt | 1 + metadata/ru.gelin.android.weather.notification.yml | 1 - .../ru.gelin.android.weather.notification/en-US/summary.txt | 1 + metadata/ru.henridellal.dialer.yml | 1 - metadata/ru.henridellal.dialer/en-US/summary.txt | 1 + metadata/ru.henridellal.emerald.yml | 1 - metadata/ru.henridellal.emerald/en-US/summary.txt | 1 + metadata/ru.henridellal.patolli.yml | 1 - metadata/ru.henridellal.patolli/en-US/summary.txt | 1 + metadata/ru.ifproject.android.afr.yml | 1 - metadata/ru.ifproject.android.afr/en-US/summary.txt | 1 + metadata/ru.meefik.busybox.yml | 1 - metadata/ru.meefik.busybox/en-US/summary.txt | 1 + metadata/ru.meefik.tzupdater.yml | 1 - metadata/ru.meefik.tzupdater/en-US/summary.txt | 1 + metadata/ru.moscow.tuzlukov.sergey.weatherlog.yml | 1 - metadata/ru.moscow.tuzlukov.sergey.weatherlog/en-US/summary.txt | 1 + metadata/ru.neverdark.silentnight.yml | 1 - metadata/ru.neverdark.silentnight/en-US/summary.txt | 1 + metadata/ru.o2genum.coregame.yml | 1 - metadata/ru.o2genum.coregame/en-US/summary.txt | 1 + metadata/ru.playsoftware.j2meloader.yml | 1 - metadata/ru.playsoftware.j2meloader/en-US/summary.txt | 1 + metadata/ru.ra66it.updaterforspotify.yml | 1 - metadata/ru.ra66it.updaterforspotify/en-US/summary.txt | 1 + metadata/ru.sash0k.bluetooth_terminal.yml | 1 - metadata/ru.sash0k.bluetooth_terminal/en-US/summary.txt | 1 + metadata/ru.subprogram.paranoidsmsblocker.yml | 1 - metadata/ru.subprogram.paranoidsmsblocker/en-US/summary.txt | 1 + metadata/ru.ttyh.neko259.notey.yml | 1 - metadata/ru.ttyh.neko259.notey/en-US/summary.txt | 1 + metadata/ru.valle.btc.yml | 1 - metadata/ru.valle.btc/en-US/summary.txt | 1 + metadata/ru.yanus171.feedexfork.yml | 1 - metadata/ru.yanus171.feedexfork/en-US/summary.txt | 1 + metadata/ru.zxalexis.ugaday.yml | 1 - metadata/ru.zxalexis.ugaday/en-US/summary.txt | 1 + metadata/ru0xdc.rtkgps.yml | 1 - metadata/ru0xdc.rtkgps/en-US/summary.txt | 1 + metadata/ryey.camcov.yml | 1 - metadata/ryey.camcov/en-US/summary.txt | 1 + metadata/ryey.easer.yml | 1 - metadata/ryey.easer/en-US/summary.txt | 1 + metadata/ryey.flock.yml | 1 - metadata/ryey.flock/en-US/summary.txt | 1 + metadata/saschpe.contactevents.yml | 1 - metadata/saschpe.contactevents/en-US/summary.txt | 1 + metadata/saschpe.poker.yml | 1 - metadata/saschpe.poker/en-US/summary.txt | 1 + metadata/science.itaintrocket.pomfshare.yml | 1 - metadata/science.itaintrocket.pomfshare/en-US/summary.txt | 1 + metadata/se.anyro.nfc_reader.yml | 1 - metadata/se.anyro.nfc_reader/en-US/summary.txt | 1 + metadata/se.bitcraze.crazyfliecontrol2.yml | 1 - metadata/se.bitcraze.crazyfliecontrol2/en-US/summary.txt | 1 + metadata/se.danielj.geometridestroyer.yml | 1 - metadata/se.danielj.geometridestroyer/en-US/summary.txt | 1 + metadata/se.embargo.retroboy.yml | 1 - metadata/se.embargo.retroboy/en-US/summary.txt | 1 + metadata/se.erikofsweden.findmyphone.yml | 1 - metadata/se.erikofsweden.findmyphone/en-US/summary.txt | 1 + metadata/se.johanhil.clipboard.yml | 1 - metadata/se.johanhil.clipboard/en-US/summary.txt | 1 + metadata/se.johanhil.duckduckgo.yml | 1 - metadata/se.johanhil.duckduckgo/en-US/summary.txt | 1 + metadata/se.leap.bitmaskclient.yml | 1 - metadata/se.leap.bitmaskclient/en-US/summary.txt | 1 + metadata/se.leap.riseupvpn.yml | 1 - metadata/se.leap.riseupvpn/en-US/summary.txt | 1 + metadata/se.manyver.yml | 1 - metadata/se.manyver/en-US/summary.txt | 1 + metadata/se.norenh.rkfread.yml | 1 - metadata/se.norenh.rkfread/en-US/summary.txt | 1 + metadata/se.oandell.riksdagen.yml | 1 - metadata/se.oandell.riksdagen/en-US/summary.txt | 1 + metadata/se.pp.mc.android.Gerberoid.yml | 1 - metadata/se.pp.mc.android.Gerberoid/en-US/summary.txt | 1 + metadata/se.traffar.dot_race.yml | 1 - metadata/se.traffar.dot_race/en-US/summary.txt | 1 + metadata/se.tube42.drum.android.yml | 1 - metadata/se.tube42.drum.android/en-US/summary.txt | 1 + metadata/se.tube42.kidsmem.android.yml | 1 - metadata/se.tube42.kidsmem.android/en-US/summary.txt | 1 + metadata/se.tube42.p9.android.yml | 1 - metadata/se.tube42.p9.android/en-US/summary.txt | 1 + metadata/seanfoy.wherering.yml | 1 - metadata/seanfoy.wherering/en-US/summary.txt | 1 + metadata/security.pEp.yml | 1 - metadata/security.pEp/en-US/summary.txt | 1 + .../sh.ftp.rocketninelabs.meditationassistant.opensource.yml | 1 - .../en-US/summary.txt | 1 + metadata/si.modrajagoda.didi.yml | 1 - metadata/si.modrajagoda.didi/en-US/summary.txt | 1 + metadata/siir.es.adbWireless.yml | 1 - metadata/siir.es.adbWireless/en-US/summary.txt | 1 + metadata/simple.reboot.com.yml | 1 - metadata/simple.reboot.com/en-US/summary.txt | 1 + metadata/sk.baka.aedict.yml | 1 - metadata/sk.baka.aedict/en-US/summary.txt | 1 + metadata/sk.halmi.fbeditplus.yml | 1 - metadata/sk.halmi.fbeditplus/en-US/summary.txt | 1 + metadata/sk.madzik.android.logcatudp.yml | 1 - metadata/sk.madzik.android.logcatudp/en-US/summary.txt | 1 + metadata/sk.vx.connectbot.yml | 1 - metadata/sk.vx.connectbot/en-US/summary.txt | 1 + metadata/sonoroxadc.garethmurfin.co.uk.yml | 1 - metadata/sonoroxadc.garethmurfin.co.uk/en-US/summary.txt | 1 + metadata/sony.hidden.servicemenu.yml | 1 - metadata/sony.hidden.servicemenu/en-US/summary.txt | 1 + metadata/souch.smp.yml | 1 - metadata/souch.smp/en-US/summary.txt | 1 + metadata/souch.smsbypass.yml | 1 - metadata/souch.smsbypass/en-US/summary.txt | 1 + metadata/space.neothefox.laytray.yml | 1 - metadata/space.neothefox.laytray/en-US/summary.txt | 1 + metadata/starcom.snd.yml | 1 - metadata/starcom.snd/en-US/summary.txt | 1 + metadata/steele.gerry.dotty.yml | 1 - metadata/steele.gerry.dotty/en-US/summary.txt | 1 + metadata/streetwalrus.usbmountr.yml | 1 - metadata/streetwalrus.usbmountr/en-US/summary.txt | 1 + metadata/subreddit.android.appstore.yml | 1 - metadata/subreddit.android.appstore/en-US/summary.txt | 1 + metadata/sun.bob.leela.yml | 1 - metadata/sun.bob.leela/en-US/summary.txt | 1 + metadata/swati4star.createpdf.yml | 1 - metadata/swati4star.createpdf/en-US/summary.txt | 1 + metadata/systems.byteswap.aiproute.yml | 1 - metadata/systems.byteswap.aiproute/en-US/summary.txt | 1 + metadata/szelok.app.twister.yml | 1 - metadata/szelok.app.twister/en-US/summary.txt | 1 + metadata/taco.apkmirror.yml | 1 - metadata/taco.apkmirror/en-US/summary.txt | 1 + metadata/teamunguided.brighttime.yml | 1 - metadata/teamunguided.brighttime/en-US/summary.txt | 1 + metadata/teaonly.droideye.yml | 1 - metadata/teaonly.droideye/en-US/summary.txt | 1 + metadata/tech.ula.yml | 1 - metadata/tech.ula/en-US/summary.txt | 1 + metadata/telegra.ph.yml | 1 - metadata/telegra.ph/en-US/summary.txt | 1 + metadata/tf.nox.wifisetup.yml | 1 - metadata/tf.nox.wifisetup/en-US/summary.txt | 1 + metadata/theakki.synctool.yml | 1 - metadata/theakki.synctool/en-US/summary.txt | 1 + metadata/theredspy15.ltecleanerfoss.yml | 1 - metadata/theredspy15.ltecleanerfoss/en-US/summary.txt | 1 + metadata/tk.al54.dev.badpixels.yml | 1 - metadata/tk.al54.dev.badpixels/en-US/summary.txt | 1 + metadata/tk.elevenk.dailybread.yml | 1 - metadata/tk.elevenk.dailybread/en-US/summary.txt | 1 + metadata/tk.giesecke.phoenix.yml | 1 - metadata/tk.giesecke.phoenix/en-US/summary.txt | 1 + metadata/tk.jordynsmediagroup.simpleirc.fdroid.yml | 1 - .../tk.jordynsmediagroup.simpleirc.fdroid/en-US/summary.txt | 1 + metadata/tk.radioactivemineral.metronome.yml | 1 - metadata/tk.radioactivemineral.metronome/en-US/summary.txt | 1 + metadata/tk.superl2.xwifi.yml | 1 - metadata/tk.superl2.xwifi/en-US/summary.txt | 1 + metadata/tkj.android.homecontrol.mythmote.yml | 1 - metadata/tkj.android.homecontrol.mythmote/en-US/summary.txt | 1 + metadata/tmendes.com.analyticalbalancedroid.yml | 1 - metadata/tmendes.com.analyticalbalancedroid/en-US/summary.txt | 1 + metadata/to.networld.android.divedroid.yml | 1 - metadata/to.networld.android.divedroid/en-US/summary.txt | 1 + metadata/tomer.com.alwaysonamoledplugin.yml | 1 - metadata/tomer.com.alwaysonamoledplugin/en-US/summary.txt | 1 + metadata/tranquvis.simplesmsremote.yml | 1 - metadata/tranquvis.simplesmsremote/en-US/summary.txt | 1 + metadata/trikita.obsqr.yml | 1 - metadata/trikita.obsqr/en-US/summary.txt | 1 + metadata/trikita.slide.yml | 1 - metadata/trikita.slide/en-US/summary.txt | 1 + metadata/trikita.talalarmo.yml | 1 - metadata/trikita.talalarmo/en-US/summary.txt | 1 + metadata/tritop.android.SLWTrafficMeterWidget.yml | 1 - metadata/tritop.android.SLWTrafficMeterWidget/en-US/summary.txt | 1 + metadata/tritop.androidSLWCpuWidget.yml | 1 - metadata/tritop.androidSLWCpuWidget/en-US/summary.txt | 1 + metadata/troop.com.freedcam.yml | 1 - metadata/troop.com.freedcam/en-US/summary.txt | 1 + metadata/tuioDroid.impl.yml | 1 - metadata/tuioDroid.impl/en-US/summary.txt | 1 + metadata/tv.piratemedia.lightcontroler.yml | 1 - metadata/tv.piratemedia.lightcontroler/en-US/summary.txt | 1 + metadata/tw.com.daxia.virtualsoftkeys.yml | 1 - metadata/tw.com.daxia.virtualsoftkeys/en-US/summary.txt | 1 + metadata/tw.qtlin.mac.airunlocker.yml | 1 - metadata/tw.qtlin.mac.airunlocker/en-US/summary.txt | 1 + metadata/tyagi.shubham.customsearch.yml | 1 - metadata/tyagi.shubham.customsearch/en-US/summary.txt | 1 + metadata/uk.ac.cam.cl.dtg.android.barcodebox.yml | 1 - metadata/uk.ac.cam.cl.dtg.android.barcodebox/en-US/summary.txt | 1 + metadata/uk.ac.ed.inf.mandelbrotmaps.yml | 1 - metadata/uk.ac.ed.inf.mandelbrotmaps/en-US/summary.txt | 1 + metadata/uk.ac.swansea.eduroamcat.yml | 1 - metadata/uk.ac.swansea.eduroamcat/en-US/summary.txt | 1 + metadata/uk.co.ashtonbrsc.android.intentintercept.yml | 1 - .../uk.co.ashtonbrsc.android.intentintercept/en-US/summary.txt | 1 + metadata/uk.co.bitethebullet.android.token.yml | 1 - metadata/uk.co.bitethebullet.android.token/en-US/summary.txt | 1 + metadata/uk.co.busydoingnothing.catverbs.yml | 1 - metadata/uk.co.busydoingnothing.catverbs/en-US/summary.txt | 1 + metadata/uk.co.busydoingnothing.prevo.yml | 1 - metadata/uk.co.busydoingnothing.prevo/en-US/summary.txt | 1 + metadata/uk.co.danieljarvis.android.flashback.yml | 1 - metadata/uk.co.danieljarvis.android.flashback/en-US/summary.txt | 1 + metadata/uk.co.jarofgreen.JustADamnCompass.yml | 1 - metadata/uk.co.jarofgreen.JustADamnCompass/en-US/summary.txt | 1 + metadata/uk.co.keepawayfromfire.screens.yml | 1 - metadata/uk.co.keepawayfromfire.screens/en-US/summary.txt | 1 + metadata/uk.co.richyhbm.monochromatic.yml | 1 - metadata/uk.co.richyhbm.monochromatic/en-US/summary.txt | 1 + metadata/uk.co.yahoo.p1rpp.calendartrigger.yml | 1 - metadata/uk.co.yahoo.p1rpp.calendartrigger/en-US/summary.txt | 1 + metadata/uk.org.boddie.android.weatherforecast.yml | 1 - .../uk.org.boddie.android.weatherforecast/en-US/summary.txt | 1 + metadata/uk.org.crimetalk.yml | 1 - metadata/uk.org.crimetalk/en-US/summary.txt | 1 + metadata/uk.org.ngo.squeezer.yml | 1 - metadata/uk.org.ngo.squeezer/en-US/summary.txt | 1 + metadata/unisiegen.photographers.activity.yml | 1 - metadata/unisiegen.photographers.activity/en-US/summary.txt | 1 + metadata/uobikiemukot.yaft.yml | 1 - metadata/uobikiemukot.yaft/en-US/summary.txt | 1 + metadata/urbanstew.RehearsalAssistant.yml | 1 - metadata/urbanstew.RehearsalAssistant/en-US/summary.txt | 1 + metadata/us.achromaticmetaphor.agram.yml | 1 - metadata/us.achromaticmetaphor.agram/en-US/summary.txt | 1 + metadata/us.achromaticmetaphor.imcktg.yml | 1 - metadata/us.achromaticmetaphor.imcktg/en-US/summary.txt | 1 + metadata/us.bravender.android.dongsa.yml | 1 - metadata/us.bravender.android.dongsa/en-US/summary.txt | 1 + metadata/us.feras.mdv.demo.yml | 1 - metadata/us.feras.mdv.demo/en-US/summary.txt | 1 + metadata/us.koller.cameraroll.yml | 1 - metadata/us.koller.cameraroll/en-US/summary.txt | 1 + metadata/us.lindanrandy.cidrcalculator.yml | 1 - metadata/us.lindanrandy.cidrcalculator/en-US/summary.txt | 1 + metadata/us.shandian.giga.yml | 1 - metadata/us.shandian.giga/en-US/summary.txt | 1 + metadata/ut.ewh.audiometrytest.yml | 1 - metadata/ut.ewh.audiometrytest/en-US/summary.txt | 1 + metadata/vik.linx.stormify.yml | 1 - metadata/vik.linx.stormify/en-US/summary.txt | 1 + metadata/vnd.blueararat.kaleidoscope6.yml | 1 - metadata/vnd.blueararat.kaleidoscope6/en-US/summary.txt | 1 + metadata/vu.de.urpool.quickdroid.yml | 1 - metadata/vu.de.urpool.quickdroid/en-US/summary.txt | 1 + metadata/wb.receiptspro.yml | 1 - metadata/wb.receiptspro/en-US/summary.txt | 1 + metadata/wiseguys.radar.yml | 1 - metadata/wiseguys.radar/en-US/summary.txt | 1 + metadata/wseemann.media.romote.yml | 1 - metadata/wseemann.media.romote/en-US/summary.txt | 1 + metadata/x1125io.initdlight.yml | 1 - metadata/x1125io.initdlight/en-US/summary.txt | 1 + metadata/x653.bullseye.yml | 1 - metadata/x653.bullseye/en-US/summary.txt | 1 + metadata/xyz.hisname.fireflyiii.yml | 1 - metadata/xyz.hisname.fireflyiii/en-US/summary.txt | 1 + metadata/xyz.iridiumion.plucklockex.yml | 1 - metadata/xyz.iridiumion.plucklockex/en-US/summary.txt | 1 + metadata/yellr.net.yellr_android.yml | 1 - metadata/yellr.net.yellr_android/en-US/summary.txt | 1 + metadata/youten.redo.ble.ibeacondetector.yml | 1 - metadata/youten.redo.ble.ibeacondetector/en-US/summary.txt | 1 + metadata/z4pp3r.flashlightwidget.yml | 1 - metadata/z4pp3r.flashlightwidget/en-US/summary.txt | 1 + metadata/za.co.lukestonehm.logicaldefence.yml | 1 - metadata/za.co.lukestonehm.logicaldefence/en-US/summary.txt | 1 + metadata/za.co.neilson.alarm.yml | 1 - metadata/za.co.neilson.alarm/en-US/summary.txt | 1 + metadata/zame.GloomyDungeons.opensource.game.yml | 1 - metadata/zame.GloomyDungeons.opensource.game/en-US/summary.txt | 1 + 1153 files changed, 576 insertions(+), 578 deletions(-) create mode 100644 metadata/ai.susi/en-US/summary.txt create mode 100644 metadata/android.nachiketa.ebookdownloader/en-US/summary.txt create mode 100644 metadata/apps.jizzu.simpletodo/en-US/summary.txt create mode 100644 metadata/at.tacticaldevc.panictrigger/en-US/summary.txt create mode 100644 metadata/cc.echonet.coolmicapp/en-US/summary.txt create mode 100644 metadata/chat.rocket.android/en-US/summary.txt create mode 100644 metadata/cl.coders.faketraveler/en-US/summary.txt create mode 100644 metadata/click.dummer.imagesms/en-US/summary.txt create mode 100644 metadata/click.dummer.notify_to_jabber/en-US/summary.txt create mode 100644 metadata/click.dummer.yidkey/en-US/summary.txt create mode 100644 metadata/com.DartChecker/en-US/summary.txt create mode 100644 metadata/com.EthanHeming.NeuralNetworkSimulator/en-US/summary.txt create mode 100644 metadata/com.GTP.eveminer/en-US/summary.txt create mode 100644 metadata/com.aaronhalbert.nosurfforreddit/en-US/summary.txt create mode 100644 metadata/com.adityakamble49.dcipher/en-US/summary.txt create mode 100644 metadata/com.alaskalinuxuser.rilcontrol/en-US/summary.txt create mode 100644 metadata/com.android.talkback/en-US/summary.txt create mode 100644 metadata/com.anpmech.launcher/en-US/summary.txt create mode 100644 metadata/com.artifex.mupdf.mini.app/en-US/summary.txt create mode 100644 metadata/com.b44t.messenger/en-US/summary.txt create mode 100644 metadata/com.bernaferrari.changedetection/en-US/summary.txt create mode 100644 metadata/com.brucelet.spacetrader/en-US/summary.txt create mode 100644 metadata/com.coboltforge.dontmind.multivnc/en-US/summary.txt create mode 100644 metadata/com.corvettecole.gotosleep/en-US/summary.txt create mode 100644 metadata/com.daniel.mobilepauker2/en-US/summary.txt create mode 100644 metadata/com.davidshewitt.admincontrol/en-US/summary.txt create mode 100644 metadata/com.example.forgottenumbrella.cardboardmuseum/en-US/summary.txt create mode 100644 metadata/com.example.harisont.librery/en-US/summary.txt create mode 100644 metadata/com.example.hochi.nextcompanion/en-US/summary.txt create mode 100644 metadata/com.example.trigger/en-US/summary.txt create mode 100644 metadata/com.fproject.cryptolitycs/en-US/summary.txt create mode 100644 metadata/com.freshollie.monkeyboard.keystoneradio/en-US/summary.txt create mode 100644 metadata/com.github.axet.filemanager/en-US/summary.txt create mode 100644 metadata/com.github.axet.smsgate/en-US/summary.txt create mode 100644 metadata/com.github.catfriend1.syncthingandroid/en-US/summary.txt create mode 100644 metadata/com.github.cvzi.screenshottile/en-US/summary.txt create mode 100644 metadata/com.github.gotify/en-US/summary.txt create mode 100644 metadata/com.github.moko256.twitlatte/en-US/summary.txt create mode 100644 metadata/com.github.postapczuk.lalauncher/en-US/summary.txt create mode 100644 metadata/com.github.yeriomin.yalpstore/en-US/summary.txt create mode 100644 metadata/com.gitlab.kreikenbaum.suntime.fdroid/en-US/summary.txt create mode 100644 metadata/com.gmail.jiwopene.temperature/en-US/summary.txt create mode 100644 metadata/com.google.android.accessibility.talkback/en-US/summary.txt create mode 100644 metadata/com.governikus.ausweisapp2/en-US/summary.txt create mode 100644 metadata/com.gsnathan.pdfviewer/en-US/summary.txt create mode 100644 metadata/com.halftough.webcomreader/en-US/summary.txt create mode 100644 metadata/com.iatfei.streakalarm/en-US/summary.txt create mode 100644 metadata/com.iboalali.sysnotifsnooze/en-US/summary.txt create mode 100644 metadata/com.indieweb.indigenous/en-US/summary.txt create mode 100644 metadata/com.internalpositioning.find3.find3app/en-US/summary.txt create mode 100644 metadata/com.iskrembilen.quasseldroid/en-US/summary.txt create mode 100644 metadata/com.james.status/en-US/summary.txt create mode 100644 metadata/com.jarsilio.android.drowser/en-US/summary.txt create mode 100644 metadata/com.jkcarino.ankieditor/en-US/summary.txt create mode 100644 metadata/com.kgurgul.cpuinfo/en-US/summary.txt create mode 100644 metadata/com.lavadip.miniVector/en-US/summary.txt create mode 100644 metadata/com.lesspass.android/en-US/summary.txt create mode 100644 metadata/com.limbo.emu.main/en-US/summary.txt create mode 100644 metadata/com.lyonbros.turtl/en-US/summary.txt create mode 100644 metadata/com.mdroid/en-US/summary.txt create mode 100644 metadata/com.money.manager.ex/en-US/summary.txt create mode 100644 metadata/com.movim.movim/en-US/summary.txt create mode 100644 metadata/com.nephi.getoffyourphone/en-US/summary.txt create mode 100644 metadata/com.nicobrailo.pianoli/en-US/summary.txt create mode 100644 metadata/com.nikhiljha.lobstersapp/en-US/summary.txt create mode 100644 metadata/com.noprestige.kanaquiz/en-US/summary.txt create mode 100644 metadata/com.oF2pks.applicationsinfo/en-US/summary.txt create mode 100644 metadata/com.oF2pks.classyshark3xodus/en-US/summary.txt create mode 100644 metadata/com.oF2pks.kalturadeviceinfos/en-US/summary.txt create mode 100644 metadata/com.oriondev.moneywallet/en-US/summary.txt create mode 100644 metadata/com.osfans.trime/en-US/summary.txt create mode 100644 metadata/com.owncloud.android/en-US/summary.txt create mode 100644 metadata/com.quchen.flashcard/en-US/summary.txt create mode 100644 metadata/com.rascarlo.adaptive.brightness.tile/en-US/summary.txt create mode 100644 metadata/com.sahdeepsingh.Bop/en-US/summary.txt create mode 100644 metadata/com.samarthdesai.repeatme/en-US/summary.txt create mode 100644 metadata/com.scraperclub.android/en-US/summary.txt create mode 100644 metadata/com.sduduzog.slimlauncher/en-US/summary.txt create mode 100644 metadata/com.simonramstedt.yoke/en-US/summary.txt create mode 100644 metadata/com.sovworks.edslite/en-US/summary.txt create mode 100644 metadata/com.stripe1.xmouse/en-US/summary.txt create mode 100644 metadata/com.suyashsrijan.forcedoze/en-US/summary.txt create mode 100644 metadata/com.tananaev.calculator/en-US/summary.txt create mode 100644 metadata/com.thermatk.android.xf.fakegapps/en-US/summary.txt create mode 100644 metadata/com.thirtydegreesray.openhub/en-US/summary.txt create mode 100644 metadata/com.tht.k3pler/en-US/summary.txt create mode 100644 metadata/com.tobykurien.webmediashare/en-US/summary.txt create mode 100644 metadata/com.ulicae.cinelog/en-US/summary.txt create mode 100644 metadata/com.wangdaye.mysplash/en-US/summary.txt create mode 100644 metadata/com.wownero.wownerujo/en-US/summary.txt create mode 100644 metadata/com.zzzmode.appopsx/en-US/summary.txt create mode 100644 metadata/community.fairphone.checkup/en-US/summary.txt create mode 100644 metadata/community.peers.internetradio/en-US/summary.txt create mode 100644 metadata/cz.dvratil.fbeventsync/en-US/summary.txt create mode 100644 metadata/cz.harvie.northdog/en-US/summary.txt create mode 100644 metadata/d.d.meshenger/en-US/summary.txt create mode 100644 metadata/de.antonarnold.android.xoverrideheadphonejackdetection/en-US/summary.txt create mode 100644 metadata/de.binary_kitchen.doorlock_app/en-US/summary.txt create mode 100644 metadata/de.blau.android/en-US/summary.txt create mode 100644 metadata/de.blocklink.pigrid/en-US/summary.txt create mode 100644 metadata/de.c3nav.droid/en-US/summary.txt create mode 100644 metadata/de.democracydeutschland.app/en-US/summary.txt create mode 100644 metadata/de.digisocken.stop_o_moto/en-US/summary.txt create mode 100644 metadata/de.drhoffmannsoftware.calcvac/en-US/summary.txt create mode 100644 metadata/de.freifunk_karte.freifunk_karte/en-US/summary.txt create mode 100644 metadata/de.fzi.bettyrieckmann.quotingstars/en-US/summary.txt create mode 100644 metadata/de.hu_berlin.eduroam/en-US/summary.txt create mode 100644 metadata/de.igloffstein.maik.aRevelation/en-US/summary.txt create mode 100644 metadata/de.kromke.andreas.mediascanner/en-US/summary.txt create mode 100644 metadata/de.kromke.andreas.musictagger/en-US/summary.txt create mode 100644 metadata/de.larcado.sesam/en-US/summary.txt create mode 100644 metadata/de.markusfisch.android.binaryeye/en-US/summary.txt create mode 100644 metadata/de.micmun.android.deufeitage/en-US/summary.txt create mode 100644 metadata/de.nodomain.tobihille.seniorlauncher/en-US/summary.txt create mode 100644 metadata/de.php_tech.piggybudget/en-US/summary.txt create mode 100644 metadata/de.r4md4c.gamedealz/en-US/summary.txt create mode 100644 metadata/de.spiritcroc.darkcroc.substratum/en-US/summary.txt create mode 100644 metadata/de.spiritcroc.defaultdarktheme_oms/en-US/summary.txt create mode 100644 metadata/de.uwepost.android.deltacam/en-US/summary.txt create mode 100644 metadata/deep.ryd.rydplayer/en-US/summary.txt create mode 100644 metadata/dk.kjeldsen.carwingsflutter/en-US/summary.txt create mode 100644 metadata/dnsfilter.android/en-US/summary.txt create mode 100644 metadata/eu.depau.etchdroid/en-US/summary.txt create mode 100644 metadata/eu.droogers.smsmatrix/en-US/summary.txt create mode 100644 metadata/eu.faircode.email/en-US/summary.txt create mode 100644 metadata/eu.faircode.netguard/en-US/summary.txt create mode 100644 metadata/eu.faircode.xlua/en-US/summary.txt create mode 100644 metadata/eu.halaser.beamctrl/en-US/summary.txt create mode 100644 metadata/eu.pretix.pretixdroid/en-US/summary.txt create mode 100644 metadata/eu.siacs.conversations.legacy/en-US/summary.txt create mode 100644 metadata/eu.siacs.conversations.voicerecorder/en-US/summary.txt create mode 100644 metadata/eu.siacs.conversations/en-US/summary.txt create mode 100644 metadata/eu.veldsoft.brainstonz/en-US/summary.txt create mode 100644 metadata/eu.veldsoft.dice.overflow/en-US/summary.txt create mode 100644 metadata/eu.veldsoft.free.klondike/en-US/summary.txt create mode 100644 metadata/eu.veldsoft.house.of.cards/en-US/summary.txt create mode 100644 metadata/eu.veldsoft.kechi/en-US/summary.txt create mode 100644 metadata/eu.veldsoft.tri.peaks/en-US/summary.txt create mode 100644 metadata/eu.veldsoft.vitosha.poker.odds/en-US/summary.txt create mode 100644 metadata/exa.lnx.a/en-US/summary.txt create mode 100644 metadata/fi.kroon.vadret/en-US/summary.txt create mode 100644 metadata/fr.bepo.clavierexterne/en-US/summary.txt create mode 100644 metadata/fr.rhaz.ipfs.sweet/en-US/summary.txt create mode 100644 metadata/fr.ubordeaux.math.paridroid/en-US/summary.txt create mode 100644 metadata/fr.witchdoctors.c4ffein.oosfirmwareextractor/en-US/summary.txt create mode 100644 metadata/friimaind.piholedroid/en-US/summary.txt create mode 100644 metadata/github.vatsal.easyweatherdemo/en-US/summary.txt create mode 100644 metadata/godau.fynn.dsbdirect/en-US/summary.txt create mode 100644 metadata/im.quicksy.client/en-US/summary.txt create mode 100644 metadata/im.vector.alpha/en-US/summary.txt create mode 100644 metadata/info.aario.mywifipasswords/en-US/summary.txt create mode 100644 metadata/info.guardianproject.courier/en-US/summary.txt create mode 100644 metadata/info.guardianproject.gilga/en-US/summary.txt create mode 100644 metadata/info.guardianproject.notepadbot/en-US/summary.txt create mode 100644 metadata/info.guardianproject.orfox/en-US/summary.txt create mode 100644 metadata/info.guardianproject.pixelknot/en-US/summary.txt create mode 100644 metadata/info.metadude.android.bitsundbaeume.schedule/en-US/summary.txt create mode 100644 metadata/info.metadude.android.congress.schedule/en-US/summary.txt create mode 100644 metadata/info.tangential.cone/en-US/summary.txt create mode 100644 metadata/info.zamojski.soft.towercollector/en-US/summary.txt create mode 100644 metadata/io.github.deweyreed.clipboardcleaner/en-US/summary.txt create mode 100644 metadata/io.github.lufte.lona/en-US/summary.txt create mode 100644 metadata/io.github.project_travel_mate/en-US/summary.txt create mode 100644 metadata/io.github.subhamtyagi.openinwhatsapp/en-US/summary.txt create mode 100644 metadata/io.github.subhamtyagi.privacyapplock/en-US/summary.txt create mode 100644 metadata/io.github.tiagoshibata.gpsdclient/en-US/summary.txt create mode 100644 metadata/io.mainframe.hacs/en-US/summary.txt create mode 100644 metadata/it.diab/en-US/summary.txt create mode 100644 metadata/joshuatee.wx/en-US/summary.txt create mode 100644 metadata/jp.ddo.hotmist.unicodepad/en-US/summary.txt create mode 100644 metadata/jp.takke.cpustats/en-US/summary.txt create mode 100644 metadata/makeinfo.com.getid/en-US/summary.txt create mode 100644 metadata/mancioboxblog.altervista.it.volumecontrol/en-US/summary.txt create mode 100644 metadata/marto.rtl_tcp_andro/en-US/summary.txt create mode 100644 metadata/mavonst.app.easylight/en-US/summary.txt create mode 100644 metadata/max.music_cyclon/en-US/summary.txt create mode 100644 metadata/mazechazer.android.wottankquiz/en-US/summary.txt create mode 100644 metadata/mbmb5.lumixextendedcontrolapp/en-US/summary.txt create mode 100644 metadata/me.alexghr.bulkshare.android.app2/en-US/summary.txt create mode 100644 metadata/me.anon.grow/en-US/summary.txt create mode 100644 metadata/me.anuraag.grader/en-US/summary.txt create mode 100644 metadata/me.anuraag.loveactualized/en-US/summary.txt create mode 100644 metadata/me.blog.korn123.easydiary/en-US/summary.txt create mode 100644 metadata/me.bpear.archonpackager/en-US/summary.txt create mode 100644 metadata/me.ccrama.redditslide/en-US/summary.txt create mode 100644 metadata/me.echeung.cdflabs/en-US/summary.txt create mode 100644 metadata/me.echeung.moemoekyun.fdroid/en-US/summary.txt create mode 100644 metadata/me.guillaumin.android.osmtracker/en-US/summary.txt create mode 100644 metadata/me.hda.urlhda/en-US/summary.txt create mode 100644 metadata/me.jakelane.wrapperforfacebook/en-US/summary.txt create mode 100644 metadata/me.jamesfrost.simpledo/en-US/summary.txt create mode 100644 metadata/me.johnmh.boogdroid/en-US/summary.txt create mode 100644 metadata/me.kuehle.carreport/en-US/summary.txt create mode 100644 metadata/me.malladi.dashcricket/en-US/summary.txt create mode 100644 metadata/me.murks.filmchecker/en-US/summary.txt create mode 100644 metadata/me.phh.superuser/en-US/summary.txt create mode 100644 metadata/me.sheimi.sgit/en-US/summary.txt create mode 100644 metadata/me.shrimadhavuk.numselapp/en-US/summary.txt create mode 100644 metadata/me.shrimadhavuk.watransmitter/en-US/summary.txt create mode 100644 metadata/me.tripsit.tripmobile/en-US/summary.txt create mode 100644 metadata/me.tsukanov.counter/en-US/summary.txt create mode 100644 metadata/me.writeily/en-US/summary.txt create mode 100644 metadata/me.zeeroooo.materialfb/en-US/summary.txt create mode 100644 metadata/menion.android.whereyougo/en-US/summary.txt create mode 100644 metadata/mixedbit.speechtrainer/en-US/summary.txt create mode 100644 metadata/mkg20001.net.samremote/en-US/summary.txt create mode 100644 metadata/mobi.boilr.boilr/en-US/summary.txt create mode 100644 metadata/mobi.cyann.nstools/en-US/summary.txt create mode 100644 metadata/mobi.maptrek/en-US/summary.txt create mode 100644 metadata/mobi.omegacentauri.PerApp/en-US/summary.txt create mode 100644 metadata/mobi.omegacentauri.SendReduced/en-US/summary.txt create mode 100644 metadata/moe.feng.nhentai/en-US/summary.txt create mode 100644 metadata/moe.martini.midictrl/en-US/summary.txt create mode 100644 metadata/moe.minori.pgpclipper/en-US/summary.txt create mode 100644 metadata/mohammad.adib.roundr/en-US/summary.txt create mode 100644 metadata/monakhv.android.samlib/en-US/summary.txt create mode 100644 metadata/mono.hg/en-US/summary.txt create mode 100644 metadata/name.gdr.acastus_photon/en-US/summary.txt create mode 100644 metadata/namlit.siteswapgenerator/en-US/summary.txt create mode 100644 metadata/negativedensity.techahashi/en-US/summary.txt create mode 100644 metadata/net.asceai.meritous/en-US/summary.txt create mode 100644 metadata/net.opendasharchive.openarchive.release/en-US/summary.txt create mode 100644 metadata/net.pp3345.ykdroid/en-US/summary.txt create mode 100644 metadata/net.schueller.peertube/en-US/summary.txt create mode 100644 metadata/net.typeblog.shelter/en-US/summary.txt create mode 100644 metadata/nl.devluuk.sleepywifi/en-US/summary.txt create mode 100644 metadata/nl.eventinfra.wifisetup/en-US/summary.txt create mode 100644 metadata/nodomain.freeyourgadget.tpmsmonitor/en-US/summary.txt create mode 100644 metadata/opencontacts.open.com.opencontacts/en-US/summary.txt create mode 100644 metadata/org.atai.TessUI/en-US/summary.txt create mode 100644 metadata/org.blitzortung.android.app/en-US/summary.txt create mode 100644 metadata/org.covolunablu.marswallpaper/en-US/summary.txt create mode 100644 metadata/org.decsync.cc/en-US/summary.txt create mode 100644 metadata/org.decsync.sparss.floss/en-US/summary.txt create mode 100644 metadata/org.droidtr.deletegapps/en-US/summary.txt create mode 100644 metadata/org.droidtr.keyboard/en-US/summary.txt create mode 100644 metadata/org.dystopia.email/en-US/summary.txt create mode 100644 metadata/org.elijaxapps.androidxmrigminer/en-US/summary.txt create mode 100644 metadata/org.example.rosary/en-US/summary.txt create mode 100644 metadata/org.flyve.mdm.agent.mqtt/en-US/summary.txt create mode 100644 metadata/org.handmadeideas.chordreader/en-US/summary.txt create mode 100644 metadata/org.jschwab.openrecipes/en-US/summary.txt create mode 100644 metadata/org.jwz.xscreensaver/en-US/summary.txt create mode 100644 metadata/org.kiwix.kiwixcustomwikivoyageeurope/en-US/summary.txt create mode 100644 metadata/org.legtux.m_316k.fortune/en-US/summary.txt create mode 100644 metadata/org.legtux.m_316k.taptheblacktiles/en-US/summary.txt create mode 100644 metadata/org.lenchan139.ncbookmark/en-US/summary.txt create mode 100644 metadata/org.lf_net.pgpunlocker/en-US/summary.txt create mode 100644 metadata/org.liberty.android.fantastischmemo/en-US/summary.txt create mode 100644 metadata/org.liberty.android.freeotpplus/en-US/summary.txt create mode 100644 metadata/org.libreflix.app/en-US/summary.txt create mode 100644 metadata/org.libreoffice.impressremote/en-US/summary.txt create mode 100644 metadata/org.ligi.ajsha/en-US/summary.txt create mode 100644 metadata/org.ligi.blexplorer/en-US/summary.txt create mode 100644 metadata/org.ligi.etheremote/en-US/summary.txt create mode 100644 metadata/org.ligi.fast/en-US/summary.txt create mode 100644 metadata/org.ligi.faster/en-US/summary.txt create mode 100644 metadata/org.ligi.gobandroid_hd/en-US/summary.txt create mode 100644 metadata/org.ligi.ipfsdroid/en-US/summary.txt create mode 100644 metadata/org.ligi.materialteatimer/en-US/summary.txt create mode 100644 metadata/org.ligi.passandroid/en-US/summary.txt create mode 100644 metadata/org.ligi.satoshiproof/en-US/summary.txt create mode 100644 metadata/org.ligi.scr/en-US/summary.txt create mode 100644 metadata/org.ligi.survivalmanual/en-US/summary.txt create mode 100644 metadata/org.ligi.vaporizercontrol/en-US/summary.txt create mode 100644 metadata/org.linphone/en-US/summary.txt create mode 100644 metadata/org.logicallycreative.movingpolygons/en-US/summary.txt create mode 100644 metadata/org.lufebe16.pysolfc/en-US/summary.txt create mode 100644 metadata/org.lumicall.android/en-US/summary.txt create mode 100644 metadata/org.mcxa.softsound/en-US/summary.txt create mode 100644 metadata/org.mozc.android.inputmethod.japanese/en-US/summary.txt create mode 100644 metadata/org.mupen64plusae.v3.alpha/en-US/summary.txt create mode 100644 metadata/org.nitri.opentopo/en-US/summary.txt create mode 100644 metadata/org.openobservatory.ooniprobe/en-US/summary.txt create mode 100644 metadata/org.ostrya.presencepublisher/en-US/summary.txt create mode 100644 metadata/org.pipoypipagames.towerjumper/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.main/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.alarmset/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.bluetooth/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.bluetoothadmin/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.clipboard/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.contactsread/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.fileread/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.filewrite/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.locationfine/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.misc/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.nfc/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.notification/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.phonestateread/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.ringermode/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.shell/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.smsnotify/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.smsread/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.smssend/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.smswrite/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.wifiaccess/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.module.wifichange/en-US/summary.txt create mode 100644 metadata/org.projectmaxs.transport.xmpp/en-US/summary.txt create mode 100644 metadata/org.projectvoodoo.otarootkeeper/en-US/summary.txt create mode 100644 metadata/org.projectvoodoo.screentestpatterns/en-US/summary.txt create mode 100644 metadata/org.projectvoodoo.simplecarrieriqdetector/en-US/summary.txt create mode 100644 metadata/org.safermobile.intheclear/en-US/summary.txt create mode 100644 metadata/org.sagemath.droid/en-US/summary.txt create mode 100644 metadata/org.saiditnet.redreader/en-US/summary.txt create mode 100644 metadata/org.sasehash.burgerwp/en-US/summary.txt create mode 100644 metadata/org.schabi.etherwake/en-US/summary.txt create mode 100644 metadata/org.schabi.kiba/en-US/summary.txt create mode 100644 metadata/org.schabi.newpipe/en-US/summary.txt create mode 100644 metadata/org.schabi.nxbookmarks.owncloud/en-US/summary.txt create mode 100644 metadata/org.schabi.nxbookmarks/en-US/summary.txt create mode 100644 metadata/org.schabi.openhitboxstreams/en-US/summary.txt create mode 100644 metadata/org.schabi.stethox/en-US/summary.txt create mode 100644 metadata/org.schabi.svgredirect/en-US/summary.txt create mode 100644 metadata/org.schabi.terminightor/en-US/summary.txt create mode 100644 metadata/org.scid.android/en-US/summary.txt create mode 100644 metadata/org.scoutant.blokish/en-US/summary.txt create mode 100644 metadata/org.scoutant.cc/en-US/summary.txt create mode 100644 metadata/org.scoutant.rpn/en-US/summary.txt create mode 100644 metadata/org.scummvm.scummvm/en-US/summary.txt create mode 100644 metadata/org.seamapdroid/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendly2048/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlyactivitytracker/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlyboardgameclock/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlycardgameone/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlydame/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlydicer/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlyintervaltimer/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlyludo/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlymemory/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlyminesweeper/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlynetmonitor/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlynotes/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlypaindiary/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlypasswordgenerator/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlypausinghealthily/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlypin/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlyrecknoningskills/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlyruler/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlysudoku/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlytapemeasure/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlytodolist/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlyweather/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlywifimanager/en-US/summary.txt create mode 100644 metadata/org.secuso.privacyfriendlyyahtzeedicer/en-US/summary.txt create mode 100644 metadata/org.segin.bfinterpreter/en-US/summary.txt create mode 100644 metadata/org.segin.ttleditor/en-US/summary.txt create mode 100644 metadata/org.sensors2.osc/en-US/summary.txt create mode 100644 metadata/org.sensors2.pd/en-US/summary.txt create mode 100644 metadata/org.servDroid.web/en-US/summary.txt create mode 100644 metadata/org.servalproject/en-US/summary.txt create mode 100644 metadata/org.shadowice.flocke.andotp/en-US/summary.txt create mode 100644 metadata/org.shirakumo.ocelot/en-US/summary.txt create mode 100644 metadata/org.shortcuts/en-US/summary.txt create mode 100644 metadata/org.sickstache/en-US/summary.txt create mode 100644 metadata/org.sipdroid.sipua/en-US/summary.txt create mode 100644 metadata/org.sixgun.ponyexpress/en-US/summary.txt create mode 100644 metadata/org.smblott.intentradio/en-US/summary.txt create mode 100644 metadata/org.smc.inputmethod.indic/en-US/summary.txt create mode 100644 metadata/org.smerty.zooborns/en-US/summary.txt create mode 100644 metadata/org.softcatala.traductor/en-US/summary.txt create mode 100644 metadata/org.softeg.slartus.forpdaplus/en-US/summary.txt create mode 100644 metadata/org.sorz.lab.tinykeepass/en-US/summary.txt create mode 100644 metadata/org.sparkleshare.android/en-US/summary.txt create mode 100644 metadata/org.strawberryforum.pollywog/en-US/summary.txt create mode 100644 metadata/org.subsurface/en-US/summary.txt create mode 100644 metadata/org.sudowars/en-US/summary.txt create mode 100644 metadata/org.sufficientlysecure.ical/en-US/summary.txt create mode 100644 metadata/org.sufficientlysecure.localcalendar/en-US/summary.txt create mode 100644 metadata/org.sufficientlysecure.standalonecalendar/en-US/summary.txt create mode 100644 metadata/org.sufficientlysecure.termbot/en-US/summary.txt create mode 100644 metadata/org.sufficientlysecure.viewer.fontpack/en-US/summary.txt create mode 100644 metadata/org.sufficientlysecure.viewer/en-US/summary.txt create mode 100644 metadata/org.sugr.gearshift/en-US/summary.txt create mode 100644 metadata/org.supertuxkart.stk/en-US/summary.txt create mode 100644 metadata/org.surrel.facebooknotifications/en-US/summary.txt create mode 100644 metadata/org.surrel.messengerbypasser/en-US/summary.txt create mode 100644 metadata/org.synergy/en-US/summary.txt create mode 100644 metadata/org.systemcall.scores/en-US/summary.txt create mode 100644 metadata/org.thiolliere.youtubestream/en-US/summary.txt create mode 100644 metadata/org.torproject.android/en-US/summary.txt create mode 100644 metadata/org.witness.sscphase1/en-US/summary.txt create mode 100644 metadata/org.zephyrsoft.sdbviewer/en-US/summary.txt create mode 100644 metadata/org.zimmob.zimlx/en-US/summary.txt create mode 100644 metadata/paulscode.android.mupen64plusae/en-US/summary.txt create mode 100644 metadata/peanutencryption.peanutencryption/en-US/summary.txt create mode 100644 metadata/pk.contender.earmouse/en-US/summary.txt create mode 100644 metadata/pl.hypeapp.endoscope/en-US/summary.txt create mode 100644 metadata/pl.hypeapp.episodie/en-US/summary.txt create mode 100644 metadata/pl.kuben.progressapp/en-US/summary.txt create mode 100644 metadata/pl.narfsoftware.thermometer/en-US/summary.txt create mode 100644 metadata/pl.net.szafraniec.NFCKey/en-US/summary.txt create mode 100644 metadata/pl.net.szafraniec.NFCTagmaker/en-US/summary.txt create mode 100644 metadata/pl.nkg.geokrety/en-US/summary.txt create mode 100644 metadata/player.efis.data.eur.rus/en-US/summary.txt create mode 100644 metadata/player.efis.data.pan.arg/en-US/summary.txt create mode 100644 metadata/player.efis.data.sah.jap/en-US/summary.txt create mode 100644 metadata/player.efis.data.usa.can/en-US/summary.txt create mode 100644 metadata/player.efis.data.zar.aus/en-US/summary.txt create mode 100644 metadata/player.efis.mfd/en-US/summary.txt create mode 100644 metadata/player.efis.pfd/en-US/summary.txt create mode 100644 metadata/press.condense.www/en-US/summary.txt create mode 100644 metadata/priv.twoerner.brightnesswidget/en-US/summary.txt create mode 100644 metadata/privacyfriendlyshoppinglist.secuso.org.privacyfriendlyshoppinglist/en-US/summary.txt create mode 100644 metadata/pro.dbro.bart/en-US/summary.txt create mode 100644 metadata/pro.oneredpixel.l9droid/en-US/summary.txt create mode 100644 metadata/pro.rudloff.openvegemap/en-US/summary.txt create mode 100644 metadata/pro.rudloff.papercraft/en-US/summary.txt create mode 100644 metadata/protect.babymonitor/en-US/summary.txt create mode 100644 metadata/protect.babysleepsounds/en-US/summary.txt create mode 100644 metadata/protect.budgetwatch/en-US/summary.txt create mode 100644 metadata/protect.card_locker/en-US/summary.txt create mode 100644 metadata/protect.gift_card_guard/en-US/summary.txt create mode 100644 metadata/protect.rentalcalc/en-US/summary.txt create mode 100644 metadata/protect.videoeditor/en-US/summary.txt create mode 100644 metadata/pt.ipleiria.mymusicqoe/en-US/summary.txt create mode 100644 metadata/pt.isec.tp.am/en-US/summary.txt create mode 100644 metadata/pt.joaomneto.titancompanion/en-US/summary.txt create mode 100644 metadata/pw.thedrhax.mosmetro/en-US/summary.txt create mode 100644 metadata/raele.concurseiro/en-US/summary.txt create mode 100644 metadata/re.jcg.playmusicexporter/en-US/summary.txt create mode 100644 metadata/remuco.client.android/en-US/summary.txt create mode 100644 metadata/rino.org.tethercompanion/en-US/summary.txt create mode 100644 metadata/rkr.simplekeyboard.inputmethod/en-US/summary.txt create mode 100644 metadata/ro.ciubex.dscautorename/en-US/summary.txt create mode 100644 metadata/ro.ieval.fonbot/en-US/summary.txt create mode 100644 metadata/ro.mihai.tpt/en-US/summary.txt create mode 100644 metadata/ro.ui.pttdroid/en-US/summary.txt create mode 100644 metadata/rodrigodavy.com.github.pixelartist/en-US/summary.txt create mode 100644 metadata/rs.pedjaapps.alogcatroot.app/en-US/summary.txt create mode 100644 metadata/ru.equestriadev.mgke/en-US/summary.txt create mode 100644 metadata/ru.exlmoto.snood21/en-US/summary.txt create mode 100644 metadata/ru.gelin.android.browser.open/en-US/summary.txt create mode 100644 metadata/ru.gelin.android.sendtosd/en-US/summary.txt create mode 100644 metadata/ru.gelin.android.weather.notification.skin.biggertext/en-US/summary.txt create mode 100644 metadata/ru.gelin.android.weather.notification.skin.blacktext/en-US/summary.txt create mode 100644 metadata/ru.gelin.android.weather.notification.skin.blacktextplus/en-US/summary.txt create mode 100644 metadata/ru.gelin.android.weather.notification.skin.whitetext/en-US/summary.txt create mode 100644 metadata/ru.gelin.android.weather.notification.skin.whitetextplus/en-US/summary.txt create mode 100644 metadata/ru.gelin.android.weather.notification/en-US/summary.txt create mode 100644 metadata/ru.henridellal.dialer/en-US/summary.txt create mode 100644 metadata/ru.henridellal.emerald/en-US/summary.txt create mode 100644 metadata/ru.henridellal.patolli/en-US/summary.txt create mode 100644 metadata/ru.ifproject.android.afr/en-US/summary.txt create mode 100644 metadata/ru.meefik.busybox/en-US/summary.txt create mode 100644 metadata/ru.meefik.tzupdater/en-US/summary.txt create mode 100644 metadata/ru.moscow.tuzlukov.sergey.weatherlog/en-US/summary.txt create mode 100644 metadata/ru.neverdark.silentnight/en-US/summary.txt create mode 100644 metadata/ru.o2genum.coregame/en-US/summary.txt create mode 100644 metadata/ru.playsoftware.j2meloader/en-US/summary.txt create mode 100644 metadata/ru.ra66it.updaterforspotify/en-US/summary.txt create mode 100644 metadata/ru.sash0k.bluetooth_terminal/en-US/summary.txt create mode 100644 metadata/ru.subprogram.paranoidsmsblocker/en-US/summary.txt create mode 100644 metadata/ru.ttyh.neko259.notey/en-US/summary.txt create mode 100644 metadata/ru.valle.btc/en-US/summary.txt create mode 100644 metadata/ru.yanus171.feedexfork/en-US/summary.txt create mode 100644 metadata/ru.zxalexis.ugaday/en-US/summary.txt create mode 100644 metadata/ru0xdc.rtkgps/en-US/summary.txt create mode 100644 metadata/ryey.camcov/en-US/summary.txt create mode 100644 metadata/ryey.easer/en-US/summary.txt create mode 100644 metadata/ryey.flock/en-US/summary.txt create mode 100644 metadata/saschpe.contactevents/en-US/summary.txt create mode 100644 metadata/saschpe.poker/en-US/summary.txt create mode 100644 metadata/science.itaintrocket.pomfshare/en-US/summary.txt create mode 100644 metadata/se.anyro.nfc_reader/en-US/summary.txt create mode 100644 metadata/se.bitcraze.crazyfliecontrol2/en-US/summary.txt create mode 100644 metadata/se.danielj.geometridestroyer/en-US/summary.txt create mode 100644 metadata/se.embargo.retroboy/en-US/summary.txt create mode 100644 metadata/se.erikofsweden.findmyphone/en-US/summary.txt create mode 100644 metadata/se.johanhil.clipboard/en-US/summary.txt create mode 100644 metadata/se.johanhil.duckduckgo/en-US/summary.txt create mode 100644 metadata/se.leap.bitmaskclient/en-US/summary.txt create mode 100644 metadata/se.leap.riseupvpn/en-US/summary.txt create mode 100644 metadata/se.manyver/en-US/summary.txt create mode 100644 metadata/se.norenh.rkfread/en-US/summary.txt create mode 100644 metadata/se.oandell.riksdagen/en-US/summary.txt create mode 100644 metadata/se.pp.mc.android.Gerberoid/en-US/summary.txt create mode 100644 metadata/se.traffar.dot_race/en-US/summary.txt create mode 100644 metadata/se.tube42.drum.android/en-US/summary.txt create mode 100644 metadata/se.tube42.kidsmem.android/en-US/summary.txt create mode 100644 metadata/se.tube42.p9.android/en-US/summary.txt create mode 100644 metadata/seanfoy.wherering/en-US/summary.txt create mode 100644 metadata/security.pEp/en-US/summary.txt create mode 100644 metadata/sh.ftp.rocketninelabs.meditationassistant.opensource/en-US/summary.txt create mode 100644 metadata/si.modrajagoda.didi/en-US/summary.txt create mode 100644 metadata/siir.es.adbWireless/en-US/summary.txt create mode 100644 metadata/simple.reboot.com/en-US/summary.txt create mode 100644 metadata/sk.baka.aedict/en-US/summary.txt create mode 100644 metadata/sk.halmi.fbeditplus/en-US/summary.txt create mode 100644 metadata/sk.madzik.android.logcatudp/en-US/summary.txt create mode 100644 metadata/sk.vx.connectbot/en-US/summary.txt create mode 100644 metadata/sonoroxadc.garethmurfin.co.uk/en-US/summary.txt create mode 100644 metadata/sony.hidden.servicemenu/en-US/summary.txt create mode 100644 metadata/souch.smp/en-US/summary.txt create mode 100644 metadata/souch.smsbypass/en-US/summary.txt create mode 100644 metadata/space.neothefox.laytray/en-US/summary.txt create mode 100644 metadata/starcom.snd/en-US/summary.txt create mode 100644 metadata/steele.gerry.dotty/en-US/summary.txt create mode 100644 metadata/streetwalrus.usbmountr/en-US/summary.txt create mode 100644 metadata/subreddit.android.appstore/en-US/summary.txt create mode 100644 metadata/sun.bob.leela/en-US/summary.txt create mode 100644 metadata/swati4star.createpdf/en-US/summary.txt create mode 100644 metadata/systems.byteswap.aiproute/en-US/summary.txt create mode 100644 metadata/szelok.app.twister/en-US/summary.txt create mode 100644 metadata/taco.apkmirror/en-US/summary.txt create mode 100644 metadata/teamunguided.brighttime/en-US/summary.txt create mode 100644 metadata/teaonly.droideye/en-US/summary.txt create mode 100644 metadata/tech.ula/en-US/summary.txt create mode 100644 metadata/telegra.ph/en-US/summary.txt create mode 100644 metadata/tf.nox.wifisetup/en-US/summary.txt create mode 100644 metadata/theakki.synctool/en-US/summary.txt create mode 100644 metadata/theredspy15.ltecleanerfoss/en-US/summary.txt create mode 100644 metadata/tk.al54.dev.badpixels/en-US/summary.txt create mode 100644 metadata/tk.elevenk.dailybread/en-US/summary.txt create mode 100644 metadata/tk.giesecke.phoenix/en-US/summary.txt create mode 100644 metadata/tk.jordynsmediagroup.simpleirc.fdroid/en-US/summary.txt create mode 100644 metadata/tk.radioactivemineral.metronome/en-US/summary.txt create mode 100644 metadata/tk.superl2.xwifi/en-US/summary.txt create mode 100644 metadata/tkj.android.homecontrol.mythmote/en-US/summary.txt create mode 100644 metadata/tmendes.com.analyticalbalancedroid/en-US/summary.txt create mode 100644 metadata/to.networld.android.divedroid/en-US/summary.txt create mode 100644 metadata/tomer.com.alwaysonamoledplugin/en-US/summary.txt create mode 100644 metadata/tranquvis.simplesmsremote/en-US/summary.txt create mode 100644 metadata/trikita.obsqr/en-US/summary.txt create mode 100644 metadata/trikita.slide/en-US/summary.txt create mode 100644 metadata/trikita.talalarmo/en-US/summary.txt create mode 100644 metadata/tritop.android.SLWTrafficMeterWidget/en-US/summary.txt create mode 100644 metadata/tritop.androidSLWCpuWidget/en-US/summary.txt create mode 100644 metadata/troop.com.freedcam/en-US/summary.txt create mode 100644 metadata/tuioDroid.impl/en-US/summary.txt create mode 100644 metadata/tv.piratemedia.lightcontroler/en-US/summary.txt create mode 100644 metadata/tw.com.daxia.virtualsoftkeys/en-US/summary.txt create mode 100644 metadata/tw.qtlin.mac.airunlocker/en-US/summary.txt create mode 100644 metadata/tyagi.shubham.customsearch/en-US/summary.txt create mode 100644 metadata/uk.ac.cam.cl.dtg.android.barcodebox/en-US/summary.txt create mode 100644 metadata/uk.ac.ed.inf.mandelbrotmaps/en-US/summary.txt create mode 100644 metadata/uk.ac.swansea.eduroamcat/en-US/summary.txt create mode 100644 metadata/uk.co.ashtonbrsc.android.intentintercept/en-US/summary.txt create mode 100644 metadata/uk.co.bitethebullet.android.token/en-US/summary.txt create mode 100644 metadata/uk.co.busydoingnothing.catverbs/en-US/summary.txt create mode 100644 metadata/uk.co.busydoingnothing.prevo/en-US/summary.txt create mode 100644 metadata/uk.co.danieljarvis.android.flashback/en-US/summary.txt create mode 100644 metadata/uk.co.jarofgreen.JustADamnCompass/en-US/summary.txt create mode 100644 metadata/uk.co.keepawayfromfire.screens/en-US/summary.txt create mode 100644 metadata/uk.co.richyhbm.monochromatic/en-US/summary.txt create mode 100644 metadata/uk.co.yahoo.p1rpp.calendartrigger/en-US/summary.txt create mode 100644 metadata/uk.org.boddie.android.weatherforecast/en-US/summary.txt create mode 100644 metadata/uk.org.crimetalk/en-US/summary.txt create mode 100644 metadata/uk.org.ngo.squeezer/en-US/summary.txt create mode 100644 metadata/unisiegen.photographers.activity/en-US/summary.txt create mode 100644 metadata/uobikiemukot.yaft/en-US/summary.txt create mode 100644 metadata/urbanstew.RehearsalAssistant/en-US/summary.txt create mode 100644 metadata/us.achromaticmetaphor.agram/en-US/summary.txt create mode 100644 metadata/us.achromaticmetaphor.imcktg/en-US/summary.txt create mode 100644 metadata/us.bravender.android.dongsa/en-US/summary.txt create mode 100644 metadata/us.feras.mdv.demo/en-US/summary.txt create mode 100644 metadata/us.koller.cameraroll/en-US/summary.txt create mode 100644 metadata/us.lindanrandy.cidrcalculator/en-US/summary.txt create mode 100644 metadata/us.shandian.giga/en-US/summary.txt create mode 100644 metadata/ut.ewh.audiometrytest/en-US/summary.txt create mode 100644 metadata/vik.linx.stormify/en-US/summary.txt create mode 100644 metadata/vnd.blueararat.kaleidoscope6/en-US/summary.txt create mode 100644 metadata/vu.de.urpool.quickdroid/en-US/summary.txt create mode 100644 metadata/wb.receiptspro/en-US/summary.txt create mode 100644 metadata/wiseguys.radar/en-US/summary.txt create mode 100644 metadata/wseemann.media.romote/en-US/summary.txt create mode 100644 metadata/x1125io.initdlight/en-US/summary.txt create mode 100644 metadata/x653.bullseye/en-US/summary.txt create mode 100644 metadata/xyz.hisname.fireflyiii/en-US/summary.txt create mode 100644 metadata/xyz.iridiumion.plucklockex/en-US/summary.txt create mode 100644 metadata/yellr.net.yellr_android/en-US/summary.txt create mode 100644 metadata/youten.redo.ble.ibeacondetector/en-US/summary.txt create mode 100644 metadata/z4pp3r.flashlightwidget/en-US/summary.txt create mode 100644 metadata/za.co.lukestonehm.logicaldefence/en-US/summary.txt create mode 100644 metadata/za.co.neilson.alarm/en-US/summary.txt create mode 100644 metadata/zame.GloomyDungeons.opensource.game/en-US/summary.txt diff --git a/metadata/ai.susi.yml b/metadata/ai.susi.yml index 16bd8d1661..b3ad0c4ba4 100644 --- a/metadata/ai.susi.yml +++ b/metadata/ai.susi.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/fossasia/susi_android IssueTracker: https://github.com/fossasia/susi_android/issues AutoName: SUSI.AI -Summary: Susi AI is an intelligent personal assistant Description: Susi AI is an intelligent Open Source personal assistant. It is fully customizable and developed by a community of developers. It is capable of chat and voice interaction by using APIS to perform actions such as music playback, diff --git a/metadata/ai.susi/en-US/summary.txt b/metadata/ai.susi/en-US/summary.txt new file mode 100644 index 0000000000..c75da55601 --- /dev/null +++ b/metadata/ai.susi/en-US/summary.txt @@ -0,0 +1 @@ +Susi AI is an intelligent personal assistant diff --git a/metadata/android.nachiketa.ebookdownloader.yml b/metadata/android.nachiketa.ebookdownloader.yml index b6ed4b3187..d534dfd3f5 100644 --- a/metadata/android.nachiketa.ebookdownloader.yml +++ b/metadata/android.nachiketa.ebookdownloader.yml @@ -9,7 +9,6 @@ IssueTracker: https://github.com/NachiketaVadera/EBookDownloader/issues Changelog: https://github.com/NachiketaVadera/EBookDownloader/releases AutoName: eBooks -Summary: Parse and find e-books to download Description: |- ''eBooks'' is an app that searches the internet for the book you request and gives you options to download the book in multiple formats (PDF, EPUB, diff --git a/metadata/android.nachiketa.ebookdownloader/en-US/summary.txt b/metadata/android.nachiketa.ebookdownloader/en-US/summary.txt new file mode 100644 index 0000000000..923e6da017 --- /dev/null +++ b/metadata/android.nachiketa.ebookdownloader/en-US/summary.txt @@ -0,0 +1 @@ +Parse and find e-books to download diff --git a/metadata/apps.jizzu.simpletodo.yml b/metadata/apps.jizzu.simpletodo.yml index 3dcd3a2ba5..8c5a6b742d 100644 --- a/metadata/apps.jizzu.simpletodo.yml +++ b/metadata/apps.jizzu.simpletodo.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/Jizzu/SimpleToDo/issues Changelog: https://github.com/Jizzu/SimpleToDo/releases AutoName: Simple ToDo -Summary: To-Do / Task list with beautiful minimalistic design and reminders Description: |- ''Simple ToDo'' will help manage your daily tasks and don't forget about important things! diff --git a/metadata/apps.jizzu.simpletodo/en-US/summary.txt b/metadata/apps.jizzu.simpletodo/en-US/summary.txt new file mode 100644 index 0000000000..aee438da94 --- /dev/null +++ b/metadata/apps.jizzu.simpletodo/en-US/summary.txt @@ -0,0 +1 @@ +To-Do / Task list with beautiful minimalistic design and reminders diff --git a/metadata/at.tacticaldevc.panictrigger.yml b/metadata/at.tacticaldevc.panictrigger.yml index 39daf6f77a..0a091df228 100644 --- a/metadata/at.tacticaldevc.panictrigger.yml +++ b/metadata/at.tacticaldevc.panictrigger.yml @@ -11,7 +11,6 @@ Changelog: https://github.com/tacticalDevC/PanicTrigger/releases Bitcoin: 1EVr5tm2kugffNy3RWPGFoug6X9v3GTxuJ AutoName: PanicTrigger -Summary: Helps you and others in case of an emergency Description: |- PanicTrigger is an Android app which can help you in case of an emergency situation. In case of an emergency you tap on a big red button which causes diff --git a/metadata/at.tacticaldevc.panictrigger/en-US/summary.txt b/metadata/at.tacticaldevc.panictrigger/en-US/summary.txt new file mode 100644 index 0000000000..955571ab06 --- /dev/null +++ b/metadata/at.tacticaldevc.panictrigger/en-US/summary.txt @@ -0,0 +1 @@ +Helps you and others in case of an emergency diff --git a/metadata/cc.echonet.coolmicapp.yml b/metadata/cc.echonet.coolmicapp.yml index 460f861307..3ef392c557 100644 --- a/metadata/cc.echonet.coolmicapp.yml +++ b/metadata/cc.echonet.coolmicapp.yml @@ -5,7 +5,6 @@ WebSite: https://coolmic.net/ SourceCode: https://github.com/CoolMicApp/CoolMicApp-Android AutoName: Cool Mic -Summary: Icecast source client Description: |- ''Cool Mic'' is an open source Icecast source client. It livestreams audio captured by your Android device’s microphone or mic in / line in jack. It diff --git a/metadata/cc.echonet.coolmicapp/en-US/summary.txt b/metadata/cc.echonet.coolmicapp/en-US/summary.txt new file mode 100644 index 0000000000..1887b9595d --- /dev/null +++ b/metadata/cc.echonet.coolmicapp/en-US/summary.txt @@ -0,0 +1 @@ +Icecast source client diff --git a/metadata/chat.rocket.android.yml b/metadata/chat.rocket.android.yml index fbed5c70ab..68a0f01e55 100644 --- a/metadata/chat.rocket.android.yml +++ b/metadata/chat.rocket.android.yml @@ -11,7 +11,6 @@ Donate: https://github.com/RocketChat/Rocket.Chat#donate Bitcoin: ac2fa967efca7f6fc1201d46bdccb875 AutoName: Rocket.Chat -Summary: Team Communication Tool Description: | '''Note:''' This FOSS build variant currently lacks any push notification support. diff --git a/metadata/chat.rocket.android/en-US/summary.txt b/metadata/chat.rocket.android/en-US/summary.txt new file mode 100644 index 0000000000..c77725bce6 --- /dev/null +++ b/metadata/chat.rocket.android/en-US/summary.txt @@ -0,0 +1 @@ +Team Communication Tool diff --git a/metadata/cl.coders.faketraveler.yml b/metadata/cl.coders.faketraveler.yml index d262a17eb7..6ec53ee817 100644 --- a/metadata/cl.coders.faketraveler.yml +++ b/metadata/cl.coders.faketraveler.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/mcastillof/FakeTraveler IssueTracker: https://github.com/mcastillof/FakeTraveler/issues AutoName: Fake Traveler -Summary: Fake your location Description: Sometimes you need to fake the location of your device (for privacy or to test an app). Fake Traveler provides you a map to select the location where you want your phone to be. Long press in the map and tap Apply button. In "..." diff --git a/metadata/cl.coders.faketraveler/en-US/summary.txt b/metadata/cl.coders.faketraveler/en-US/summary.txt new file mode 100644 index 0000000000..af5d3dd8bb --- /dev/null +++ b/metadata/cl.coders.faketraveler/en-US/summary.txt @@ -0,0 +1 @@ +Fake your location diff --git a/metadata/click.dummer.imagesms.yml b/metadata/click.dummer.imagesms.yml index 82091db7b7..1dc9448f8d 100644 --- a/metadata/click.dummer.imagesms.yml +++ b/metadata/click.dummer.imagesms.yml @@ -7,7 +7,6 @@ WebSite: https://github.com/no-go/ImageSms SourceCode: https://github.com/no-go/ImageSms AutoName: Image SMS -Summary: Send very small photos with long text SMS and without MMS or internet Description: | Image SMS uses long text SMS to send a very small picture (NOT MMS or Internet). It uses base64 technique (similar to a email attachment) to transfer data. It is a bare metal App and Open Source on github. If you want to enlarge the features, you have to do it by your own! diff --git a/metadata/click.dummer.imagesms/en-US/summary.txt b/metadata/click.dummer.imagesms/en-US/summary.txt new file mode 100644 index 0000000000..5e87756dcd --- /dev/null +++ b/metadata/click.dummer.imagesms/en-US/summary.txt @@ -0,0 +1 @@ +Send very small photos with long text SMS and without MMS or internet diff --git a/metadata/click.dummer.notify_to_jabber.yml b/metadata/click.dummer.notify_to_jabber.yml index 8e0f05fc28..bc36b59096 100644 --- a/metadata/click.dummer.notify_to_jabber.yml +++ b/metadata/click.dummer.notify_to_jabber.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/no-go/NotifyRelay/issues Changelog: https://github.com/no-go/NotifyRelay/releases AutoName: Notify2Jabber -Summary: Send almost all text notifications to a Jabber account or your Gotify server Description: | Sometimes a new giant smartphone is too big for me at parties. It's nice to be able to redirect all my messages to a little old one. In an emergency you can at least answer your real friends via SMS. My app redirects almost everything to a Jabber account or to a Gotify server. It's a little everyday hack that I don't want to keep from the FOSS community. diff --git a/metadata/click.dummer.notify_to_jabber/en-US/summary.txt b/metadata/click.dummer.notify_to_jabber/en-US/summary.txt new file mode 100644 index 0000000000..e974731132 --- /dev/null +++ b/metadata/click.dummer.notify_to_jabber/en-US/summary.txt @@ -0,0 +1 @@ +Send almost all text notifications to a Jabber account or your Gotify server diff --git a/metadata/click.dummer.yidkey.yml b/metadata/click.dummer.yidkey.yml index 9f23b42508..843898531c 100644 --- a/metadata/click.dummer.yidkey.yml +++ b/metadata/click.dummer.yidkey.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/no-go/YiddishKeyboard IssueTracker: https://github.com/no-go/YiddishKeyboard/issues AutoName: YidKey KD -Summary: Yiddish keyboard (Compatibility Decomposition) Description: | If you study the Jewish language and can't use a Gboard keyboard, then the hebrew keyboard is often not enough and a few letters are missing. YidKey is supposed to make up for this and simplify the input of Yiddish words. diff --git a/metadata/click.dummer.yidkey/en-US/summary.txt b/metadata/click.dummer.yidkey/en-US/summary.txt new file mode 100644 index 0000000000..b683c4611e --- /dev/null +++ b/metadata/click.dummer.yidkey/en-US/summary.txt @@ -0,0 +1 @@ +Yiddish keyboard (Compatibility Decomposition) diff --git a/metadata/com.DartChecker.yml b/metadata/com.DartChecker.yml index ae4409c701..ca73c50271 100644 --- a/metadata/com.DartChecker.yml +++ b/metadata/com.DartChecker.yml @@ -6,7 +6,6 @@ SourceCode: https://gitlab.com/onestepb/dart-checker/tree/HEAD IssueTracker: https://gitlab.com/onestepb/dart-checker/issues AutoName: Dart Checker -Summary: Dart scoreboard/counter for physical dart matches Description: |- Dart Checker takes care of your score, while you are playing darts alone or with friends. Its the better form of a scoreboard. No manual calculating diff --git a/metadata/com.DartChecker/en-US/summary.txt b/metadata/com.DartChecker/en-US/summary.txt new file mode 100644 index 0000000000..8a8b1d51a5 --- /dev/null +++ b/metadata/com.DartChecker/en-US/summary.txt @@ -0,0 +1 @@ +Dart scoreboard/counter for physical dart matches diff --git a/metadata/com.EthanHeming.NeuralNetworkSimulator.yml b/metadata/com.EthanHeming.NeuralNetworkSimulator.yml index f3425feaf0..728b8d5889 100644 --- a/metadata/com.EthanHeming.NeuralNetworkSimulator.yml +++ b/metadata/com.EthanHeming.NeuralNetworkSimulator.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/Xipher7934/NeuralNetworkSimulator IssueTracker: https://github.com/Xipher7934/NeuralNetworkSimulator/issues AutoName: Neural Network Simulator -Summary: Educational tool to learn about computational neuroscience and electrophysology Description: |- Neural network nodes, or \'neurons\', are simulated brain cells. Neurons can be created by tapping anywhere on the screen. diff --git a/metadata/com.EthanHeming.NeuralNetworkSimulator/en-US/summary.txt b/metadata/com.EthanHeming.NeuralNetworkSimulator/en-US/summary.txt new file mode 100644 index 0000000000..30033e1696 --- /dev/null +++ b/metadata/com.EthanHeming.NeuralNetworkSimulator/en-US/summary.txt @@ -0,0 +1 @@ +Educational tool to learn about computational neuroscience and electrophysology diff --git a/metadata/com.GTP.eveminer.yml b/metadata/com.GTP.eveminer.yml index 5663f8caee..ac1646fcaa 100644 --- a/metadata/com.GTP.eveminer.yml +++ b/metadata/com.GTP.eveminer.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/Somethingweirdhere/Mining-Helper-for-EVE-Online IssueTracker: https://github.com/Somethingweirdhere/Mining-Helper-for-EVE-Online/issues AutoName: EVE Mining Calc -Summary: Mining Helper for EVE Online Description: |- This simple app let's you select some ores and will fetch their prices in Tradehubs. Then it will display them sorted by your profit so you don't have to diff --git a/metadata/com.GTP.eveminer/en-US/summary.txt b/metadata/com.GTP.eveminer/en-US/summary.txt new file mode 100644 index 0000000000..ae8f1eb06b --- /dev/null +++ b/metadata/com.GTP.eveminer/en-US/summary.txt @@ -0,0 +1 @@ +Mining Helper for EVE Online diff --git a/metadata/com.aaronhalbert.nosurfforreddit.yml b/metadata/com.aaronhalbert.nosurfforreddit.yml index 748c85bb71..a74f1082f2 100644 --- a/metadata/com.aaronhalbert.nosurfforreddit.yml +++ b/metadata/com.aaronhalbert.nosurfforreddit.yml @@ -8,7 +8,6 @@ IssueTracker: https://github.com/ajh3/NoSurfForReddit/issues Changelog: https://github.com/ajh3/NoSurfForReddit/releases AutoName: NoSurf for reddit -Summary: Browse the top posts on Reddit without infinite scrolling or addictive features Description: |- "NoSurf for reddit" is the world's first **non-addictive** Reddit client. diff --git a/metadata/com.aaronhalbert.nosurfforreddit/en-US/summary.txt b/metadata/com.aaronhalbert.nosurfforreddit/en-US/summary.txt new file mode 100644 index 0000000000..7d68c37a69 --- /dev/null +++ b/metadata/com.aaronhalbert.nosurfforreddit/en-US/summary.txt @@ -0,0 +1 @@ +Browse the top posts on Reddit without infinite scrolling or addictive features diff --git a/metadata/com.adityakamble49.dcipher.yml b/metadata/com.adityakamble49.dcipher.yml index ff05b18769..9e9d8c8ec6 100644 --- a/metadata/com.adityakamble49.dcipher.yml +++ b/metadata/com.adityakamble49.dcipher.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/adityakamble49/dcipher-app/issues Changelog: https://github.com/adityakamble49/dcipher-app/releases AutoName: DCipher -Summary: secret Text with 100% offline Encryption Description: |- D'Cipher helps users to share their sensitive information with control. diff --git a/metadata/com.adityakamble49.dcipher/en-US/summary.txt b/metadata/com.adityakamble49.dcipher/en-US/summary.txt new file mode 100644 index 0000000000..1f86928bf3 --- /dev/null +++ b/metadata/com.adityakamble49.dcipher/en-US/summary.txt @@ -0,0 +1 @@ +secret Text with 100% offline Encryption diff --git a/metadata/com.alaskalinuxuser.rilcontrol.yml b/metadata/com.alaskalinuxuser.rilcontrol.yml index 281004fd54..a3059ebeb8 100644 --- a/metadata/com.alaskalinuxuser.rilcontrol.yml +++ b/metadata/com.alaskalinuxuser.rilcontrol.yml @@ -7,7 +7,6 @@ IssueTracker: https://gitlab.com/alaskalinuxuser/app_ril_control/issues Changelog: https://gitlab.com/alaskalinuxuser/app_ril_control/tags AutoName: Ril Control -Summary: Control the RIL-daemon process Description: |- This app allows you to stop or start the ril-daemon process on your Oreo Android phone with the tap of a button. diff --git a/metadata/com.alaskalinuxuser.rilcontrol/en-US/summary.txt b/metadata/com.alaskalinuxuser.rilcontrol/en-US/summary.txt new file mode 100644 index 0000000000..38cd466620 --- /dev/null +++ b/metadata/com.alaskalinuxuser.rilcontrol/en-US/summary.txt @@ -0,0 +1 @@ +Control the RIL-daemon process diff --git a/metadata/com.android.talkback.yml b/metadata/com.android.talkback.yml index 009e6bf91e..75bce9875d 100644 --- a/metadata/com.android.talkback.yml +++ b/metadata/com.android.talkback.yml @@ -5,7 +5,6 @@ WebSite: https://support.google.com/accessibility/android/answer/6283677?hl=en SourceCode: https://github.com/google/talkback Name: TalkBack (legacy) -Summary: Accessibility improvements Description: |- TalkBack is an Accessibility Service that helps blind and vision-impaired users interact with their devices more easily. diff --git a/metadata/com.android.talkback/en-US/summary.txt b/metadata/com.android.talkback/en-US/summary.txt new file mode 100644 index 0000000000..a36b47f57d --- /dev/null +++ b/metadata/com.android.talkback/en-US/summary.txt @@ -0,0 +1 @@ +Accessibility improvements diff --git a/metadata/com.anpmech.launcher.yml b/metadata/com.anpmech.launcher.yml index 39c88f168d..bd41206645 100644 --- a/metadata/com.anpmech.launcher.yml +++ b/metadata/com.anpmech.launcher.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/KeikaiLauncher/KeikaiLauncher/issues Changelog: https://github.com/KeikaiLauncher/KeikaiLauncher/releases AutoName: Keikai Launcher -Summary: Fast, minimalistic and leightweight launcher Description: | A fast, minimalistic and lightweight search-based launcher. diff --git a/metadata/com.anpmech.launcher/en-US/summary.txt b/metadata/com.anpmech.launcher/en-US/summary.txt new file mode 100644 index 0000000000..ce6bf829cf --- /dev/null +++ b/metadata/com.anpmech.launcher/en-US/summary.txt @@ -0,0 +1 @@ +Fast, minimalistic and leightweight launcher diff --git a/metadata/com.artifex.mupdf.mini.app.yml b/metadata/com.artifex.mupdf.mini.app.yml index ade3ab5561..ed47ae56f3 100644 --- a/metadata/com.artifex.mupdf.mini.app.yml +++ b/metadata/com.artifex.mupdf.mini.app.yml @@ -7,7 +7,6 @@ SourceCode: https://git.ghostscript.com/?p=mupdf-android-viewer-mini.git;a=summa IssueTracker: https://bugs.ghostscript.com/ AutoName: MuPDF mini -Summary: Minimalist viewer for PDF, XPS, CBZ, unprotected EPUB, and FB2 documents Description: |- ''MuPDF Mini Viewer'' is a minimalist Android app that uses the MuPDF library to view PDF, XPS, CBZ, unprotected EPUB, and FB2 documents. diff --git a/metadata/com.artifex.mupdf.mini.app/en-US/summary.txt b/metadata/com.artifex.mupdf.mini.app/en-US/summary.txt new file mode 100644 index 0000000000..c5093c8203 --- /dev/null +++ b/metadata/com.artifex.mupdf.mini.app/en-US/summary.txt @@ -0,0 +1 @@ +Minimalist viewer for PDF, XPS, CBZ, unprotected EPUB, and FB2 documents diff --git a/metadata/com.b44t.messenger.yml b/metadata/com.b44t.messenger.yml index 1c2939ac75..611888d20b 100644 --- a/metadata/com.b44t.messenger.yml +++ b/metadata/com.b44t.messenger.yml @@ -9,7 +9,6 @@ Donate: https://delta.chat/en/contribute Bitcoin: 18e3zwis2raitdZVhEhHHT7xG6oXsZte9L AutoName: Delta Chat -Summary: Communicate instantly via e-mail Description: |- Delta Chat is a messaging app that is completely compatible with the existing e-mail infrastructure. diff --git a/metadata/com.b44t.messenger/en-US/summary.txt b/metadata/com.b44t.messenger/en-US/summary.txt new file mode 100644 index 0000000000..d77524f568 --- /dev/null +++ b/metadata/com.b44t.messenger/en-US/summary.txt @@ -0,0 +1 @@ +Communicate instantly via e-mail diff --git a/metadata/com.bernaferrari.changedetection.yml b/metadata/com.bernaferrari.changedetection.yml index f70c34059a..dd78b70677 100644 --- a/metadata/com.bernaferrari.changedetection.yml +++ b/metadata/com.bernaferrari.changedetection.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/bernaferrari/ChangeDetection IssueTracker: https://github.com/bernaferrari/ChangeDetection/issues AutoName: Change Detection -Summary: Automatically track website changes in background Description: |- ''Change Detection'' tracks changes on websites you otherwise would visit frequently to see if there is something new. Use cases: diff --git a/metadata/com.bernaferrari.changedetection/en-US/summary.txt b/metadata/com.bernaferrari.changedetection/en-US/summary.txt new file mode 100644 index 0000000000..5bae14487a --- /dev/null +++ b/metadata/com.bernaferrari.changedetection/en-US/summary.txt @@ -0,0 +1 @@ +Automatically track website changes in background diff --git a/metadata/com.brucelet.spacetrader.yml b/metadata/com.brucelet.spacetrader.yml index 597d00b90b..a900011c28 100644 --- a/metadata/com.brucelet.spacetrader.yml +++ b/metadata/com.brucelet.spacetrader.yml @@ -5,7 +5,6 @@ SourceCode: https://bitbucket.org/brucelet/space-trader/src IssueTracker: https://bitbucket.org/brucelet/space-trader/issues AutoName: Space Trader -Summary: Port of the Palm OS game of the same name Description: |- Space Trader is a port of the Palm OS game of the same name, created by Pieter Spronck. A classic among Palm gamers of the era, it was named Freeware Game of diff --git a/metadata/com.brucelet.spacetrader/en-US/summary.txt b/metadata/com.brucelet.spacetrader/en-US/summary.txt new file mode 100644 index 0000000000..d0f8fdaa4a --- /dev/null +++ b/metadata/com.brucelet.spacetrader/en-US/summary.txt @@ -0,0 +1 @@ +Port of the Palm OS game of the same name diff --git a/metadata/com.coboltforge.dontmind.multivnc.yml b/metadata/com.coboltforge.dontmind.multivnc.yml index 1314a304df..c38b64a203 100644 --- a/metadata/com.coboltforge.dontmind.multivnc.yml +++ b/metadata/com.coboltforge.dontmind.multivnc.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/bk138/multivnc/issues LiberapayID: '1537855' AutoName: MultiVNC -Summary: VNC viewer that aims to be easy to use and fast Description: |- It includes the following features: diff --git a/metadata/com.coboltforge.dontmind.multivnc/en-US/summary.txt b/metadata/com.coboltforge.dontmind.multivnc/en-US/summary.txt new file mode 100644 index 0000000000..a42e3e2387 --- /dev/null +++ b/metadata/com.coboltforge.dontmind.multivnc/en-US/summary.txt @@ -0,0 +1 @@ +VNC viewer that aims to be easy to use and fast diff --git a/metadata/com.corvettecole.gotosleep.yml b/metadata/com.corvettecole.gotosleep.yml index 3a271c495a..0ddf2153b5 100644 --- a/metadata/com.corvettecole.gotosleep.yml +++ b/metadata/com.corvettecole.gotosleep.yml @@ -8,7 +8,6 @@ Changelog: https://github.com/CorvetteCole/GotoSleep/releases Donate: http://paypal.me/CGerdemann AutoName: Go to Sleep -Summary: Reminds you to go to sleep... until you do Description: |- GotoSleep reminds you when it's time to go to bed. But it also lets you setup custom reminders. It also lets you use "smart reminders" – which nag diff --git a/metadata/com.corvettecole.gotosleep/en-US/summary.txt b/metadata/com.corvettecole.gotosleep/en-US/summary.txt new file mode 100644 index 0000000000..c2f961c5c0 --- /dev/null +++ b/metadata/com.corvettecole.gotosleep/en-US/summary.txt @@ -0,0 +1 @@ +Reminds you to go to sleep... until you do diff --git a/metadata/com.daniel.mobilepauker2.yml b/metadata/com.daniel.mobilepauker2.yml index 3ee63d602d..b90db01af8 100644 --- a/metadata/com.daniel.mobilepauker2.yml +++ b/metadata/com.daniel.mobilepauker2.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/dfrits/MobilePauker2 IssueTracker: https://github.com/dfrits/MobilePauker2/issues AutoName: MobilePauker++ -Summary: Learn intuitively with flash cards and synchronize your lesson with Dropbox Description: |- This app is based on the PC-Version [http://pauker.sourceforge.net Pauker] and the diff --git a/metadata/com.daniel.mobilepauker2/en-US/summary.txt b/metadata/com.daniel.mobilepauker2/en-US/summary.txt new file mode 100644 index 0000000000..0a1eaaf2ba --- /dev/null +++ b/metadata/com.daniel.mobilepauker2/en-US/summary.txt @@ -0,0 +1 @@ +Learn intuitively with flash cards and synchronize your lesson with Dropbox diff --git a/metadata/com.davidshewitt.admincontrol.yml b/metadata/com.davidshewitt.admincontrol.yml index 71d5dccd68..e4290b08d7 100644 --- a/metadata/com.davidshewitt.admincontrol.yml +++ b/metadata/com.davidshewitt.admincontrol.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/linux-colonel/AdminControl IssueTracker: https://github.com/linux-colonel/AdminControl/issues AutoName: AdminControl -Summary: Additional security settings Description: Allows you to disable the fingerprint reader on the Lock Screen without deleting all of your fingerprints. diff --git a/metadata/com.davidshewitt.admincontrol/en-US/summary.txt b/metadata/com.davidshewitt.admincontrol/en-US/summary.txt new file mode 100644 index 0000000000..c10ab31126 --- /dev/null +++ b/metadata/com.davidshewitt.admincontrol/en-US/summary.txt @@ -0,0 +1 @@ +Additional security settings diff --git a/metadata/com.example.forgottenumbrella.cardboardmuseum.yml b/metadata/com.example.forgottenumbrella.cardboardmuseum.yml index ff1bef8f3b..e9c5f056ff 100644 --- a/metadata/com.example.forgottenumbrella.cardboardmuseum.yml +++ b/metadata/com.example.forgottenumbrella.cardboardmuseum.yml @@ -7,7 +7,6 @@ IssueTracker: https://gitlab.com/ForgottenUmbrella/cardboardmuseum/issues Changelog: https://gitlab.com/ForgottenUmbrella/cardboardmuseum/blob/HEAD/CHANGELOG.md AutoName: Cardboard Museum -Summary: Periodically change wallpaper using Danbooru Description: | A Muzei 3.0 plugin for the (potentially NSFW) [https://danbooru.donmai.us/ Danbooru] imageboard, which sets the wallpaper to an (anime/manga-style) image diff --git a/metadata/com.example.forgottenumbrella.cardboardmuseum/en-US/summary.txt b/metadata/com.example.forgottenumbrella.cardboardmuseum/en-US/summary.txt new file mode 100644 index 0000000000..407032095e --- /dev/null +++ b/metadata/com.example.forgottenumbrella.cardboardmuseum/en-US/summary.txt @@ -0,0 +1 @@ +Periodically change wallpaper using Danbooru diff --git a/metadata/com.example.harisont.librery.yml b/metadata/com.example.harisont.librery.yml index b0271890c1..873eb1f22a 100644 --- a/metadata/com.example.harisont.librery.yml +++ b/metadata/com.example.harisont.librery.yml @@ -8,7 +8,6 @@ IssueTracker: https://gitlab.com/harisont/Librery/issues Changelog: https://gitlab.com/harisont/Librery/tags AutoName: Librery -Summary: Manage your eBooks Description: |- Library is a Kotlin app that helps you to keep track of the books you have read or want to read. diff --git a/metadata/com.example.harisont.librery/en-US/summary.txt b/metadata/com.example.harisont.librery/en-US/summary.txt new file mode 100644 index 0000000000..aeeadd8cc3 --- /dev/null +++ b/metadata/com.example.harisont.librery/en-US/summary.txt @@ -0,0 +1 @@ +Manage your eBooks diff --git a/metadata/com.example.hochi.nextcompanion.yml b/metadata/com.example.hochi.nextcompanion.yml index e503f04373..ff5d99b448 100644 --- a/metadata/com.example.hochi.nextcompanion.yml +++ b/metadata/com.example.hochi.nextcompanion.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/h0chi/next-companion IssueTracker: https://github.com/h0chi/next-companion/issues AutoName: NextCompanion -Summary: Rogue client for nextbike (unofficial) Description: |- A minimalistic client for Nextbike. Still under early development, use with care. diff --git a/metadata/com.example.hochi.nextcompanion/en-US/summary.txt b/metadata/com.example.hochi.nextcompanion/en-US/summary.txt new file mode 100644 index 0000000000..2f58e96b7b --- /dev/null +++ b/metadata/com.example.hochi.nextcompanion/en-US/summary.txt @@ -0,0 +1 @@ +Rogue client for nextbike (unofficial) diff --git a/metadata/com.example.trigger.yml b/metadata/com.example.trigger.yml index 68198c1f9c..d86cfedda0 100644 --- a/metadata/com.example.trigger.yml +++ b/metadata/com.example.trigger.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/mwarning/trigger IssueTracker: https://github.com/mwarning/trigger/issues AutoName: Trigger -Summary: Open a door over WiFi or the Internet Description: | Open/Close doors via HTTP or SSH. diff --git a/metadata/com.example.trigger/en-US/summary.txt b/metadata/com.example.trigger/en-US/summary.txt new file mode 100644 index 0000000000..688160fe8c --- /dev/null +++ b/metadata/com.example.trigger/en-US/summary.txt @@ -0,0 +1 @@ +Open a door over WiFi or the Internet diff --git a/metadata/com.fproject.cryptolitycs.yml b/metadata/com.fproject.cryptolitycs.yml index f709a15d80..8ec835f9f1 100644 --- a/metadata/com.fproject.cryptolitycs.yml +++ b/metadata/com.fproject.cryptolitycs.yml @@ -8,7 +8,6 @@ SourceCode: https://gitlab.com/lszathmary/Cryptolitycs/tree/HEAD IssueTracker: https://gitlab.com/lszathmary/Cryptolitycs/issues AutoName: Cryptolitycs -Summary: Cryptocurrency tracker Description: | The primary goal of the application is to allow the user to follow the cryptocurrency market. Cryptolitycs gives quick and easy access to cryptocurrency related information. diff --git a/metadata/com.fproject.cryptolitycs/en-US/summary.txt b/metadata/com.fproject.cryptolitycs/en-US/summary.txt new file mode 100644 index 0000000000..7c62dc94b1 --- /dev/null +++ b/metadata/com.fproject.cryptolitycs/en-US/summary.txt @@ -0,0 +1 @@ +Cryptocurrency tracker diff --git a/metadata/com.freshollie.monkeyboard.keystoneradio.yml b/metadata/com.freshollie.monkeyboard.keystoneradio.yml index cceee4dda6..41872df33d 100644 --- a/metadata/com.freshollie.monkeyboard.keystoneradio.yml +++ b/metadata/com.freshollie.monkeyboard.keystoneradio.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/freshollie/monkeyboard-radio-android/issues Changelog: https://github.com/freshollie/monkeyboard-radio-android/releases AutoName: Monkeyboard Keystone Radio -Summary: Monkeyboard FM & DAB/DAB+ radio interface Description: |- ''Monkeyboard Keystone Radio'' interfaces with a Monkeyboard and provides a control and feedback interface for the user. The Monkeyboard communicates diff --git a/metadata/com.freshollie.monkeyboard.keystoneradio/en-US/summary.txt b/metadata/com.freshollie.monkeyboard.keystoneradio/en-US/summary.txt new file mode 100644 index 0000000000..d6373bf455 --- /dev/null +++ b/metadata/com.freshollie.monkeyboard.keystoneradio/en-US/summary.txt @@ -0,0 +1 @@ +Monkeyboard FM & DAB/DAB+ radio interface diff --git a/metadata/com.github.axet.filemanager.yml b/metadata/com.github.axet.filemanager.yml index 8192e3d618..ff7b268875 100644 --- a/metadata/com.github.axet.filemanager.yml +++ b/metadata/com.github.axet.filemanager.yml @@ -6,7 +6,6 @@ IssueTracker: https://gitlab.com/axet/android-file-manager/issues LiberapayID: '1370123' AutoName: File Manager -Summary: File Manager with root browser Description: |- File Manager with two panels, smart copy/move dialogs, easy open/share files, multiple files sources including: root, SAF and direct files access. diff --git a/metadata/com.github.axet.filemanager/en-US/summary.txt b/metadata/com.github.axet.filemanager/en-US/summary.txt new file mode 100644 index 0000000000..966aecb478 --- /dev/null +++ b/metadata/com.github.axet.filemanager/en-US/summary.txt @@ -0,0 +1 @@ +File Manager with root browser diff --git a/metadata/com.github.axet.smsgate.yml b/metadata/com.github.axet.smsgate.yml index d3e93c1582..5de64785c6 100644 --- a/metadata/com.github.axet.smsgate.yml +++ b/metadata/com.github.axet.smsgate.yml @@ -7,7 +7,6 @@ IssueTracker: https://gitlab.com/axet/android-sms-gate/issues LiberapayID: '1370123' AutoName: SMS Gate -Summary: Backup all your SMS to an IMAP server or a local folder Description: |- You should be able to control all data produced by your phone and be able to collect it all into one place (cloud / p2p or local). diff --git a/metadata/com.github.axet.smsgate/en-US/summary.txt b/metadata/com.github.axet.smsgate/en-US/summary.txt new file mode 100644 index 0000000000..c429408e45 --- /dev/null +++ b/metadata/com.github.axet.smsgate/en-US/summary.txt @@ -0,0 +1 @@ +Backup all your SMS to an IMAP server or a local folder diff --git a/metadata/com.github.catfriend1.syncthingandroid.yml b/metadata/com.github.catfriend1.syncthingandroid.yml index da715bb282..9b2f8ecf86 100644 --- a/metadata/com.github.catfriend1.syncthingandroid.yml +++ b/metadata/com.github.catfriend1.syncthingandroid.yml @@ -8,7 +8,6 @@ Changelog: https://github.com/Catfriend1/syncthing-android/releases LiberapayID: '1534877' AutoName: Syncthing-Fork -Summary: File synchronization Description: |- This is a fork of [[com.nutomic.syncthingandroid]] that brings major enhancements like: diff --git a/metadata/com.github.catfriend1.syncthingandroid/en-US/summary.txt b/metadata/com.github.catfriend1.syncthingandroid/en-US/summary.txt new file mode 100644 index 0000000000..b1415ac439 --- /dev/null +++ b/metadata/com.github.catfriend1.syncthingandroid/en-US/summary.txt @@ -0,0 +1 @@ +File synchronization diff --git a/metadata/com.github.cvzi.screenshottile.yml b/metadata/com.github.cvzi.screenshottile.yml index 22131eb24a..342aeea2f8 100644 --- a/metadata/com.github.cvzi.screenshottile.yml +++ b/metadata/com.github.cvzi.screenshottile.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/cvzi/ScreenshotTile IssueTracker: https://github.com/cvzi/ScreenshotTile/issues AutoName: Screenshot Tile (NoRoot) -Summary: Quick settings tile for screenshots Description: |- Adds a button/tile to the quick settings panel to take screenshots. diff --git a/metadata/com.github.cvzi.screenshottile/en-US/summary.txt b/metadata/com.github.cvzi.screenshottile/en-US/summary.txt new file mode 100644 index 0000000000..244d5d1886 --- /dev/null +++ b/metadata/com.github.cvzi.screenshottile/en-US/summary.txt @@ -0,0 +1 @@ +Quick settings tile for screenshots diff --git a/metadata/com.github.gotify.yml b/metadata/com.github.gotify.yml index 81b15fd152..c3332a28ab 100644 --- a/metadata/com.github.gotify.yml +++ b/metadata/com.github.gotify.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/gotify/android IssueTracker: https://github.com/gotify/android/issues AutoName: Gotify -Summary: A client for receiving push notifications Description: |- Gotify is a service for sending and receiving push notifications. This app subscribes to [https://github.com/gotify/server gotify/server] and creates push notifications for incoming messages. diff --git a/metadata/com.github.gotify/en-US/summary.txt b/metadata/com.github.gotify/en-US/summary.txt new file mode 100644 index 0000000000..493720f4a9 --- /dev/null +++ b/metadata/com.github.gotify/en-US/summary.txt @@ -0,0 +1 @@ +A client for receiving push notifications diff --git a/metadata/com.github.moko256.twitlatte.yml b/metadata/com.github.moko256.twitlatte.yml index cbf7829c40..806cebefdf 100644 --- a/metadata/com.github.moko256.twitlatte.yml +++ b/metadata/com.github.moko256.twitlatte.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/moko256/twitlatte IssueTracker: https://github.com/moko256/twitlatte/issues AutoName: twitlatte -Summary: Twitter, Mastodon and Pleroma client Description: SNS client specialized to read in chronorogical order. You can access Twitter, Mastodon and Pleroma with API. ''Twitlatte'' supports multiple accounts. diff --git a/metadata/com.github.moko256.twitlatte/en-US/summary.txt b/metadata/com.github.moko256.twitlatte/en-US/summary.txt new file mode 100644 index 0000000000..e7edfa0855 --- /dev/null +++ b/metadata/com.github.moko256.twitlatte/en-US/summary.txt @@ -0,0 +1 @@ +Twitter, Mastodon and Pleroma client diff --git a/metadata/com.github.postapczuk.lalauncher.yml b/metadata/com.github.postapczuk.lalauncher.yml index 0e8268946a..6c9d55b15b 100644 --- a/metadata/com.github.postapczuk.lalauncher.yml +++ b/metadata/com.github.postapczuk.lalauncher.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/light-launcher/Light-Android-Launcher IssueTracker: https://github.com/light-launcher/Light-Android-Launcher/issues AutoName: Light Android Launcher -Summary: Lightweight app launcher Description: |- Configurable, super lightweight app launcher with a low memory usage and small install size. diff --git a/metadata/com.github.postapczuk.lalauncher/en-US/summary.txt b/metadata/com.github.postapczuk.lalauncher/en-US/summary.txt new file mode 100644 index 0000000000..8a17dd7d2f --- /dev/null +++ b/metadata/com.github.postapczuk.lalauncher/en-US/summary.txt @@ -0,0 +1 @@ +Lightweight app launcher diff --git a/metadata/com.github.yeriomin.yalpstore.yml b/metadata/com.github.yeriomin.yalpstore.yml index d7cec68869..e1442672c2 100644 --- a/metadata/com.github.yeriomin.yalpstore.yml +++ b/metadata/com.github.yeriomin.yalpstore.yml @@ -12,7 +12,6 @@ LiberapayID: '34895' Bitcoin: 14HvYHKe6joHbQjVdAPd1Ha1yXaGS2pVTW AutoName: Yalp Store -Summary: Download apks from Google Play Store Description: |- Yalp Store lets you download apps '''directly''' from Google Play Store '''as apk files'''. It can search for '''updates''' of installed apps and lets you diff --git a/metadata/com.github.yeriomin.yalpstore/en-US/summary.txt b/metadata/com.github.yeriomin.yalpstore/en-US/summary.txt new file mode 100644 index 0000000000..5f3d36d534 --- /dev/null +++ b/metadata/com.github.yeriomin.yalpstore/en-US/summary.txt @@ -0,0 +1 @@ +Download apks from Google Play Store diff --git a/metadata/com.gitlab.kreikenbaum.suntime.fdroid.yml b/metadata/com.gitlab.kreikenbaum.suntime.fdroid.yml index 31b3815dd6..5c7bdbcbcf 100644 --- a/metadata/com.gitlab.kreikenbaum.suntime.fdroid.yml +++ b/metadata/com.gitlab.kreikenbaum.suntime.fdroid.yml @@ -6,7 +6,6 @@ SourceCode: https://gitlab.com/kreikenbaum/suntime-app/tree/HEAD IssueTracker: https://gitlab.com/kreikenbaum/suntime-app/issues AutoName: Sun Time -Summary: Align your biorhythm with the sun Description: |- When the sun is at the highest point, it's noon, so it's 12:00 p.m., right? That's the way things should be. This app shows you the solar time at your location. 12:00 p.m. is natural solar noon, and the sun is at its highest point. 12:00 a.m. is the natural solar midnight, and the sun is at its lowest point. See solar time in comparison to your zone time in the main app, and see the solar time in a nifty widget. You can use this app to wake up at a solar time of your choosing. diff --git a/metadata/com.gitlab.kreikenbaum.suntime.fdroid/en-US/summary.txt b/metadata/com.gitlab.kreikenbaum.suntime.fdroid/en-US/summary.txt new file mode 100644 index 0000000000..fb60f89088 --- /dev/null +++ b/metadata/com.gitlab.kreikenbaum.suntime.fdroid/en-US/summary.txt @@ -0,0 +1 @@ +Align your biorhythm with the sun diff --git a/metadata/com.gmail.jiwopene.temperature.yml b/metadata/com.gmail.jiwopene.temperature.yml index 6edc07e971..495ee22290 100644 --- a/metadata/com.gmail.jiwopene.temperature.yml +++ b/metadata/com.gmail.jiwopene.temperature.yml @@ -8,7 +8,6 @@ IssueTracker: https://gitlab.com/jiwopene/temperature-android/issues Changelog: https://gitlab.com/jiwopene/temperature-android/tags AutoName: Temp. monitor -Summary: Shows and logs HW temperature Description: |- Simple Android application that shows hardware temperatures from /sys/class/thermal and BatteryManager. diff --git a/metadata/com.gmail.jiwopene.temperature/en-US/summary.txt b/metadata/com.gmail.jiwopene.temperature/en-US/summary.txt new file mode 100644 index 0000000000..0163c77c46 --- /dev/null +++ b/metadata/com.gmail.jiwopene.temperature/en-US/summary.txt @@ -0,0 +1 @@ +Shows and logs HW temperature diff --git a/metadata/com.google.android.accessibility.talkback.yml b/metadata/com.google.android.accessibility.talkback.yml index 75efa5395c..bf3e3f9959 100644 --- a/metadata/com.google.android.accessibility.talkback.yml +++ b/metadata/com.google.android.accessibility.talkback.yml @@ -5,7 +5,6 @@ WebSite: https://support.google.com/accessibility/android/answer/6283677?hl=en SourceCode: https://github.com/google/talkback AutoName: TalkBack -Summary: Accessibility improvements Description: |- TalkBack is an Accessibility Service that helps blind and vision-impaired users interact with their devices more easily. diff --git a/metadata/com.google.android.accessibility.talkback/en-US/summary.txt b/metadata/com.google.android.accessibility.talkback/en-US/summary.txt new file mode 100644 index 0000000000..a36b47f57d --- /dev/null +++ b/metadata/com.google.android.accessibility.talkback/en-US/summary.txt @@ -0,0 +1 @@ +Accessibility improvements diff --git a/metadata/com.governikus.ausweisapp2.yml b/metadata/com.governikus.ausweisapp2.yml index 8a68d65ae8..b86f325dec 100644 --- a/metadata/com.governikus.ausweisapp2.yml +++ b/metadata/com.governikus.ausweisapp2.yml @@ -5,7 +5,6 @@ WebSite: https://www.ausweisapp.bund.de/ SourceCode: https://github.com/Governikus/AusweisApp2 IssueTracker: https://github.com/Governikus/AusweisApp2/issues -Summary: ePerso mit dem Handy nutzen Description: |- Mit der Online-Ausweisfunktion des Personalausweises und des elektronischen Aufenthaltstitels können Sie sich im Internet ausweisen. diff --git a/metadata/com.governikus.ausweisapp2/en-US/summary.txt b/metadata/com.governikus.ausweisapp2/en-US/summary.txt new file mode 100644 index 0000000000..96ab8dfacc --- /dev/null +++ b/metadata/com.governikus.ausweisapp2/en-US/summary.txt @@ -0,0 +1 @@ +ePerso mit dem Handy nutzen diff --git a/metadata/com.gsnathan.pdfviewer.yml b/metadata/com.gsnathan.pdfviewer.yml index ae15e1ac71..7da2935467 100644 --- a/metadata/com.gsnathan.pdfviewer.yml +++ b/metadata/com.gsnathan.pdfviewer.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/JavaCafe01/PdfViewer/issues Donate: https://www.paypal.me/gsnathan AutoName: Pdf Viewer Plus -Summary: A simple PDF viewer Description: Pdf Viewer Plus is a smooth PDF viewer written in Java. It contains a simple user interface, multiple themes, and the ability to share a PDF. diff --git a/metadata/com.gsnathan.pdfviewer/en-US/summary.txt b/metadata/com.gsnathan.pdfviewer/en-US/summary.txt new file mode 100644 index 0000000000..caf91b817a --- /dev/null +++ b/metadata/com.gsnathan.pdfviewer/en-US/summary.txt @@ -0,0 +1 @@ +A simple PDF viewer diff --git a/metadata/com.halftough.webcomreader.yml b/metadata/com.halftough.webcomreader.yml index f4494ea647..75a440ea0a 100644 --- a/metadata/com.halftough.webcomreader.yml +++ b/metadata/com.halftough.webcomreader.yml @@ -5,7 +5,6 @@ SourceCode: https://gitlab.com/halftough/webcom-reader IssueTracker: https://gitlab.com/halftough/webcom-reader/issues AutoName: Tinte Webcoms -Summary: Reader for selected webcomics Description: |- ''Webcom Reader'' allows you to pick webcomics from supported titles and add them to your library. Marks read, download them to read offline. diff --git a/metadata/com.halftough.webcomreader/en-US/summary.txt b/metadata/com.halftough.webcomreader/en-US/summary.txt new file mode 100644 index 0000000000..b92546a575 --- /dev/null +++ b/metadata/com.halftough.webcomreader/en-US/summary.txt @@ -0,0 +1 @@ +Reader for selected webcomics diff --git a/metadata/com.iatfei.streakalarm.yml b/metadata/com.iatfei.streakalarm.yml index 155727c565..88b9691981 100644 --- a/metadata/com.iatfei.streakalarm.yml +++ b/metadata/com.iatfei.streakalarm.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/fei0316/snapstreak-alarm IssueTracker: https://github.com/fei0316/snapstreak-alarm/issues AutoName: Streak Alarm -Summary: Snapchat Streaks Reminder Description: |- Reminds you to keep streaks by firing notification at user-defined intervals. Only works if you have friends. diff --git a/metadata/com.iatfei.streakalarm/en-US/summary.txt b/metadata/com.iatfei.streakalarm/en-US/summary.txt new file mode 100644 index 0000000000..6fa7b1e27a --- /dev/null +++ b/metadata/com.iatfei.streakalarm/en-US/summary.txt @@ -0,0 +1 @@ +Snapchat Streaks Reminder diff --git a/metadata/com.iboalali.sysnotifsnooze.yml b/metadata/com.iboalali.sysnotifsnooze.yml index 5130061f32..2fbd032c6d 100644 --- a/metadata/com.iboalali.sysnotifsnooze.yml +++ b/metadata/com.iboalali.sysnotifsnooze.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/iboalali/sysnotifsnooze/issues Name: Hide "running in the background" Notification AutoName: Hide \"running in the background\" Notification -Summary: Hide the annoying "running in the background" notification Description: Hide the annoying "running in the background" notification with this simple and small app diff --git a/metadata/com.iboalali.sysnotifsnooze/en-US/summary.txt b/metadata/com.iboalali.sysnotifsnooze/en-US/summary.txt new file mode 100644 index 0000000000..ca630c2c50 --- /dev/null +++ b/metadata/com.iboalali.sysnotifsnooze/en-US/summary.txt @@ -0,0 +1 @@ +Hide the annoying "running in the background" notification diff --git a/metadata/com.indieweb.indigenous.yml b/metadata/com.indieweb.indigenous.yml index 2a5c9395f0..8a3389dbb3 100644 --- a/metadata/com.indieweb.indigenous.yml +++ b/metadata/com.indieweb.indigenous.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/swentel/indigenous-android/issues Changelog: https://github.com/swentel/indigenous-android/releases AutoName: Indigenous -Summary: IndieWeb Micropub and Microsub Client Description: |- An app with extensions for sharing information to micropub endpoints and reading from microsub endpoints. More information on diff --git a/metadata/com.indieweb.indigenous/en-US/summary.txt b/metadata/com.indieweb.indigenous/en-US/summary.txt new file mode 100644 index 0000000000..900ff13e13 --- /dev/null +++ b/metadata/com.indieweb.indigenous/en-US/summary.txt @@ -0,0 +1 @@ +IndieWeb Micropub and Microsub Client diff --git a/metadata/com.internalpositioning.find3.find3app.yml b/metadata/com.internalpositioning.find3.find3app.yml index 6ea7c1f3f4..42f962e07d 100644 --- a/metadata/com.internalpositioning.find3.find3app.yml +++ b/metadata/com.internalpositioning.find3.find3app.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/schollz/find3-android-scanner/issues Changelog: https://github.com/schollz/find3-android-scanner/releases AutoName: FIND3 Scanner -Summary: Scan Bluetooth and WiFi for FIND3 Description: |- ''FIND3'' is a minimal Android app for using with [https://www.internalpositioning.com/ FIND3]. This app will allow you to use diff --git a/metadata/com.internalpositioning.find3.find3app/en-US/summary.txt b/metadata/com.internalpositioning.find3.find3app/en-US/summary.txt new file mode 100644 index 0000000000..ddb4206ecd --- /dev/null +++ b/metadata/com.internalpositioning.find3.find3app/en-US/summary.txt @@ -0,0 +1 @@ +Scan Bluetooth and WiFi for FIND3 diff --git a/metadata/com.iskrembilen.quasseldroid.yml b/metadata/com.iskrembilen.quasseldroid.yml index becf24f6c7..4930eef07b 100644 --- a/metadata/com.iskrembilen.quasseldroid.yml +++ b/metadata/com.iskrembilen.quasseldroid.yml @@ -6,7 +6,6 @@ IssueTracker: https://git.kuschku.de/justJanne/QuasselDroid-ng/issues Donate: https://www.patreon.com/justjanne Name: Quasseldroid -Summary: Client for Quassel IRC Description: |- Chat comfortably. Everywhere. diff --git a/metadata/com.iskrembilen.quasseldroid/en-US/summary.txt b/metadata/com.iskrembilen.quasseldroid/en-US/summary.txt new file mode 100644 index 0000000000..e3dd9f72d6 --- /dev/null +++ b/metadata/com.iskrembilen.quasseldroid/en-US/summary.txt @@ -0,0 +1 @@ +Client for Quassel IRC diff --git a/metadata/com.james.status.yml b/metadata/com.james.status.yml index b7110a14d9..e8b4874b7d 100644 --- a/metadata/com.james.status.yml +++ b/metadata/com.james.status.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/fennifith/Status/issues Changelog: https://github.com/fennifith/Status/releases AutoName: Status -Summary: An overlay-based statusbar replacement Description: Status is a status bar replacement that draws an overlay on top of the system-generated status bar. This means that the actual status bar is only hidden under the replacement; touch gestures are not overridden, and the standard notification diff --git a/metadata/com.james.status/en-US/summary.txt b/metadata/com.james.status/en-US/summary.txt new file mode 100644 index 0000000000..f27e85869f --- /dev/null +++ b/metadata/com.james.status/en-US/summary.txt @@ -0,0 +1 @@ +An overlay-based statusbar replacement diff --git a/metadata/com.jarsilio.android.drowser.yml b/metadata/com.jarsilio.android.drowser.yml index bb48339182..c90c0605b8 100644 --- a/metadata/com.jarsilio.android.drowser.yml +++ b/metadata/com.jarsilio.android.drowser.yml @@ -6,7 +6,6 @@ IssueTracker: https://gitlab.com/juanitobananas/drowser/issues Bitcoin: 16DXeCxxKGvepYLehyHSr3M1nv1s1eUotZ AutoName: Drowser -Summary: Simple background app killer Description: |- Avoid rogue apps from running in the background with Drowser. diff --git a/metadata/com.jarsilio.android.drowser/en-US/summary.txt b/metadata/com.jarsilio.android.drowser/en-US/summary.txt new file mode 100644 index 0000000000..4d3f295ae8 --- /dev/null +++ b/metadata/com.jarsilio.android.drowser/en-US/summary.txt @@ -0,0 +1 @@ +Simple background app killer diff --git a/metadata/com.jkcarino.ankieditor.yml b/metadata/com.jkcarino.ankieditor.yml index eb9c1a334e..876f30109f 100644 --- a/metadata/com.jkcarino.ankieditor.yml +++ b/metadata/com.jkcarino.ankieditor.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/jkennethcarino/AnkiEditor IssueTracker: https://github.com/jkennethcarino/AnkiEditor/issues AutoName: AnkiEditor -Summary: An advanced note editor plug-in for AnkiDroid Description: |- AnkiEditor is an advanced note editor plug-in for AnkiDroid, a spaced repetition flashcard program for Android. AnkiEditor allows you to create basic notes; use WYSIWYG editor that can format text, set text foreground and background color, insert table/link, etc. similar to Anki on PCs. diff --git a/metadata/com.jkcarino.ankieditor/en-US/summary.txt b/metadata/com.jkcarino.ankieditor/en-US/summary.txt new file mode 100644 index 0000000000..baba6e043f --- /dev/null +++ b/metadata/com.jkcarino.ankieditor/en-US/summary.txt @@ -0,0 +1 @@ +An advanced note editor plug-in for AnkiDroid diff --git a/metadata/com.kgurgul.cpuinfo.yml b/metadata/com.kgurgul.cpuinfo.yml index f362c42976..84ceeca153 100644 --- a/metadata/com.kgurgul.cpuinfo.yml +++ b/metadata/com.kgurgul.cpuinfo.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/kamgurgul/cpu-info IssueTracker: https://github.com/kamgurgul/cpu-info/issues Changelog: https://github.com/kamgurgul/cpu-info/releases -Summary: Information about device hardware and software Description: |- CPU Info provide main information about hardware and software of your device: diff --git a/metadata/com.kgurgul.cpuinfo/en-US/summary.txt b/metadata/com.kgurgul.cpuinfo/en-US/summary.txt new file mode 100644 index 0000000000..e8f1eaa16c --- /dev/null +++ b/metadata/com.kgurgul.cpuinfo/en-US/summary.txt @@ -0,0 +1 @@ +Information about device hardware and software diff --git a/metadata/com.lavadip.miniVector.yml b/metadata/com.lavadip.miniVector.yml index 12b6dd1437..9d09ea742b 100644 --- a/metadata/com.lavadip.miniVector.yml +++ b/metadata/com.lavadip.miniVector.yml @@ -8,7 +8,6 @@ SourceCode: https://github.com/LiMium/mini-vector-android Changelog: https://github.com/LiMium/mini-vector-android/blob/HEAD/CHANGES.rst AutoName: miniVector -Summary: Open team collaboration Description: |- A simplified fork of the [[im.vector.alpha]] Android app. diff --git a/metadata/com.lavadip.miniVector/en-US/summary.txt b/metadata/com.lavadip.miniVector/en-US/summary.txt new file mode 100644 index 0000000000..2a9b3af91e --- /dev/null +++ b/metadata/com.lavadip.miniVector/en-US/summary.txt @@ -0,0 +1 @@ +Open team collaboration diff --git a/metadata/com.lesspass.android.yml b/metadata/com.lesspass.android.yml index 388d7f0548..dad60e3c2c 100644 --- a/metadata/com.lesspass.android.yml +++ b/metadata/com.lesspass.android.yml @@ -5,7 +5,6 @@ WebSite: https://lesspass.com/ SourceCode: https://github.com/lesspass/lesspass IssueTracker: https://github.com/lesspass/lesspass/issues -Summary: Generate unique passwords for your accounts based on a master password Description: |- LessPass is a stateless password manager. It derives a site, a login and a master password to generate a unique password. You don't need to sync your password vault across every device. diff --git a/metadata/com.lesspass.android/en-US/summary.txt b/metadata/com.lesspass.android/en-US/summary.txt new file mode 100644 index 0000000000..dcd133c1b7 --- /dev/null +++ b/metadata/com.lesspass.android/en-US/summary.txt @@ -0,0 +1 @@ +Generate unique passwords for your accounts based on a master password diff --git a/metadata/com.limbo.emu.main.yml b/metadata/com.limbo.emu.main.yml index 6710e5bf31..7a7ca4f178 100644 --- a/metadata/com.limbo.emu.main.yml +++ b/metadata/com.limbo.emu.main.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/limboemu/limbo IssueTracker: https://github.com/limboemu/limbo/issues AutoName: Limbo x86 PC Emulator -Summary: A QEMU-based emulator Description: |- Limbo is a qemu-based x86 architecture emulator for android devices. With limbo, you can emulate a complete desktop computer on your device and diff --git a/metadata/com.limbo.emu.main/en-US/summary.txt b/metadata/com.limbo.emu.main/en-US/summary.txt new file mode 100644 index 0000000000..73ade7fdb5 --- /dev/null +++ b/metadata/com.limbo.emu.main/en-US/summary.txt @@ -0,0 +1 @@ +A QEMU-based emulator diff --git a/metadata/com.lyonbros.turtl.yml b/metadata/com.lyonbros.turtl.yml index fdbb88a525..064d26bf9d 100644 --- a/metadata/com.lyonbros.turtl.yml +++ b/metadata/com.lyonbros.turtl.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/turtl/fdroid IssueTracker: https://github.com/turtl/tracker/issues AutoName: Turtl -Summary: A secure, encrypted Evernote alternative Description: |- Turtl lets you take notes, bookmark websites, and store documents for sensitive projects. From sharing passwords with your coworkers to tracking research on an article you're writing, Turtl keeps it all safe from everyone but you and those you share with. diff --git a/metadata/com.lyonbros.turtl/en-US/summary.txt b/metadata/com.lyonbros.turtl/en-US/summary.txt new file mode 100644 index 0000000000..8bde7a9b2b --- /dev/null +++ b/metadata/com.lyonbros.turtl/en-US/summary.txt @@ -0,0 +1 @@ +A secure, encrypted Evernote alternative diff --git a/metadata/com.mdroid.yml b/metadata/com.mdroid.yml index 29e0fa911a..5f996381bf 100644 --- a/metadata/com.mdroid.yml +++ b/metadata/com.mdroid.yml @@ -7,7 +7,6 @@ Donate: https://github.com/SkyzohKey/M-Droid#donations Bitcoin: 18BqyV9mNbFLi5HNNnfUprnPJyJDFP59Xh AutoName: M-Droid -Summary: Unofficial Material Designed client for F-Droid Description: |- This is M-Droid, a drop-in replacement for the F-Droid client. It provides the same features but in a Material Design way that is both nice to see and easy to use. diff --git a/metadata/com.mdroid/en-US/summary.txt b/metadata/com.mdroid/en-US/summary.txt new file mode 100644 index 0000000000..2b346abc45 --- /dev/null +++ b/metadata/com.mdroid/en-US/summary.txt @@ -0,0 +1 @@ +Unofficial Material Designed client for F-Droid diff --git a/metadata/com.money.manager.ex.yml b/metadata/com.money.manager.ex.yml index b9bbcab1f3..1b137a9def 100644 --- a/metadata/com.money.manager.ex.yml +++ b/metadata/com.money.manager.ex.yml @@ -8,7 +8,6 @@ Changelog: https://github.com/moneymanagerex/android-money-manager-ex/milestones Donate: https://www.paypal.com/cgi-bin/webscr?cmd=_s-xclick&hosted_button_id=5U7RXC25C9UES&source=url AutoName: Money Manager Ex -Summary: Money management and expenses tracking Description: |- A simple and easy-to-use application to manage personal finances, bank accounts, family budget, and so on. It's main goal is to add a mobile implementation for diff --git a/metadata/com.money.manager.ex/en-US/summary.txt b/metadata/com.money.manager.ex/en-US/summary.txt new file mode 100644 index 0000000000..d95fe55889 --- /dev/null +++ b/metadata/com.money.manager.ex/en-US/summary.txt @@ -0,0 +1 @@ +Money management and expenses tracking diff --git a/metadata/com.movim.movim.yml b/metadata/com.movim.movim.yml index 5a9cfb712c..4f4f754b3d 100644 --- a/metadata/com.movim.movim.yml +++ b/metadata/com.movim.movim.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/movim/movim_android IssueTracker: https://github.com/movim/movim_android/issues AutoName: Movim -Summary: Decentralized Social Network Description: |- Client for [https://movim.eu Movim], a distributed social networking platform that tries to protect your privacy and comes with a set of interesting features, diff --git a/metadata/com.movim.movim/en-US/summary.txt b/metadata/com.movim.movim/en-US/summary.txt new file mode 100644 index 0000000000..2c984cff2c --- /dev/null +++ b/metadata/com.movim.movim/en-US/summary.txt @@ -0,0 +1 @@ +Decentralized Social Network diff --git a/metadata/com.nephi.getoffyourphone.yml b/metadata/com.nephi.getoffyourphone.yml index 54e644b23b..20f8d69740 100644 --- a/metadata/com.nephi.getoffyourphone.yml +++ b/metadata/com.nephi.getoffyourphone.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/Alikaraki95/Getoffyourphone IssueTracker: https://github.com/Alikaraki95/Getoffyourphone/issues AutoName: Get Off Your Phone -Summary: Control procrastination with an app locker Description: |- Useful for everyone, anytime & anywhere. End procrastination with this simple app that locks down your selected apps for a specific time! diff --git a/metadata/com.nephi.getoffyourphone/en-US/summary.txt b/metadata/com.nephi.getoffyourphone/en-US/summary.txt new file mode 100644 index 0000000000..82cf7c2aa0 --- /dev/null +++ b/metadata/com.nephi.getoffyourphone/en-US/summary.txt @@ -0,0 +1 @@ +Control procrastination with an app locker diff --git a/metadata/com.nicobrailo.pianoli.yml b/metadata/com.nicobrailo.pianoli.yml index a21547f18b..c194c396c2 100644 --- a/metadata/com.nicobrailo.pianoli.yml +++ b/metadata/com.nicobrailo.pianoli.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/nicolasbrailo/PianOli/issues Changelog: https://github.com/nicolasbrailo/PianOli/releases AutoName: PianOli -Summary: Baby game to keep your device safe from random baby-taps Description: |- Have a baby curious about shiny tablets and phones? Use this app as a baby-game and, more importantly, to prevent random taps of a baby from diff --git a/metadata/com.nicobrailo.pianoli/en-US/summary.txt b/metadata/com.nicobrailo.pianoli/en-US/summary.txt new file mode 100644 index 0000000000..db9d6be462 --- /dev/null +++ b/metadata/com.nicobrailo.pianoli/en-US/summary.txt @@ -0,0 +1 @@ +Baby game to keep your device safe from random baby-taps diff --git a/metadata/com.nikhiljha.lobstersapp.yml b/metadata/com.nikhiljha.lobstersapp.yml index 8ae74287ca..0701b06c01 100644 --- a/metadata/com.nikhiljha.lobstersapp.yml +++ b/metadata/com.nikhiljha.lobstersapp.yml @@ -6,7 +6,6 @@ SourceCode: https://gitlab.com/nikhiljha/lobsters-app/tree/HEAD IssueTracker: https://gitlab.com/nikhiljha/lobsters-app/issues Name: Lobsters App -Summary: An app for lobste.rs Description: |- This is an app for [https://lobste.rs/ lobste.rs] and its sister sites. Contributions are welcome. diff --git a/metadata/com.nikhiljha.lobstersapp/en-US/summary.txt b/metadata/com.nikhiljha.lobstersapp/en-US/summary.txt new file mode 100644 index 0000000000..250941c8db --- /dev/null +++ b/metadata/com.nikhiljha.lobstersapp/en-US/summary.txt @@ -0,0 +1 @@ +An app for lobste.rs diff --git a/metadata/com.noprestige.kanaquiz.yml b/metadata/com.noprestige.kanaquiz.yml index 06a3f2cf31..0afe3354c3 100644 --- a/metadata/com.noprestige.kanaquiz.yml +++ b/metadata/com.noprestige.kanaquiz.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/theblackwidower/KanaQuiz IssueTracker: https://github.com/theblackwidower/KanaQuiz/issues AutoName: The Kana Quiz -Summary: A simple app to quiz the user on identifying Japanese characters Description: |- Are you trying to learn Japanese, but can't seem to remember the pronunciation of the basic Hiragana or Katakana character set? diff --git a/metadata/com.noprestige.kanaquiz/en-US/summary.txt b/metadata/com.noprestige.kanaquiz/en-US/summary.txt new file mode 100644 index 0000000000..86bd176f18 --- /dev/null +++ b/metadata/com.noprestige.kanaquiz/en-US/summary.txt @@ -0,0 +1 @@ +A simple app to quiz the user on identifying Japanese characters diff --git a/metadata/com.oF2pks.applicationsinfo.yml b/metadata/com.oF2pks.applicationsinfo.yml index afbe382cd8..ff78175fb4 100644 --- a/metadata/com.oF2pks.applicationsinfo.yml +++ b/metadata/com.oF2pks.applicationsinfo.yml @@ -5,7 +5,6 @@ SourceCode: https://bitbucket.org/oF2pks/fdroid-applications-info/src IssueTracker: https://forum.xda-developers.com/android/software-hacking/dexdump-xodus-trackers-apk-static-t3833391 AutoName: apps_Packages Info -Summary: Updated ApplicationsInfos with colors & mini-tags (and basic fixes) Description: |- Quickly show all possible android states for all installed packages: diff --git a/metadata/com.oF2pks.applicationsinfo/en-US/summary.txt b/metadata/com.oF2pks.applicationsinfo/en-US/summary.txt new file mode 100644 index 0000000000..84aced8763 --- /dev/null +++ b/metadata/com.oF2pks.applicationsinfo/en-US/summary.txt @@ -0,0 +1 @@ +Updated ApplicationsInfos with colors & mini-tags (and basic fixes) diff --git a/metadata/com.oF2pks.classyshark3xodus.yml b/metadata/com.oF2pks.classyshark3xodus.yml index e2b22cce7e..879b73c096 100644 --- a/metadata/com.oF2pks.classyshark3xodus.yml +++ b/metadata/com.oF2pks.classyshark3xodus.yml @@ -6,7 +6,6 @@ WebSite: https://forum.xda-developers.com/android/software-hacking/dexdump-xodus SourceCode: https://bitbucket.org/oF2pks/fdroid-classyshark3xodus/src AutoName: ClassyShark3xodus -Summary: Scan apps for trackers Description: |- Checks apps for code signatures of known trackers (provided by Exodus). Also can list all classes for launchable (via the app drawer) packages. diff --git a/metadata/com.oF2pks.classyshark3xodus/en-US/summary.txt b/metadata/com.oF2pks.classyshark3xodus/en-US/summary.txt new file mode 100644 index 0000000000..1828913f1b --- /dev/null +++ b/metadata/com.oF2pks.classyshark3xodus/en-US/summary.txt @@ -0,0 +1 @@ +Scan apps for trackers diff --git a/metadata/com.oF2pks.kalturadeviceinfos.yml b/metadata/com.oF2pks.kalturadeviceinfos.yml index e8a1ec10c6..1bb88ec3c7 100644 --- a/metadata/com.oF2pks.kalturadeviceinfos.yml +++ b/metadata/com.oF2pks.kalturadeviceinfos.yml @@ -6,7 +6,6 @@ SourceCode: https://bitbucket.org/oF2pks/kaltura-device-info-android/src IssueTracker: https://forum.xda-developers.com/android/apps-games/appfoss-googleserviceframework-gsf-t3849908 AutoName: (F-Droid) Kaltura Device Info -Summary: GSF, Widevine L1/2/3, Treble & A/B device infos (+other IDs) Description: |- Re-branded KalturaDeviceInfo to provides GSF id (needed for Google uncertified devices), checks about Widevine & media decoders plus detection diff --git a/metadata/com.oF2pks.kalturadeviceinfos/en-US/summary.txt b/metadata/com.oF2pks.kalturadeviceinfos/en-US/summary.txt new file mode 100644 index 0000000000..5767cd7424 --- /dev/null +++ b/metadata/com.oF2pks.kalturadeviceinfos/en-US/summary.txt @@ -0,0 +1 @@ +GSF, Widevine L1/2/3, Treble & A/B device infos (+other IDs) diff --git a/metadata/com.oriondev.moneywallet.yml b/metadata/com.oriondev.moneywallet.yml index f390506849..aeccf73f8b 100644 --- a/metadata/com.oriondev.moneywallet.yml +++ b/metadata/com.oriondev.moneywallet.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/AndreAle94/moneywallet/issues Bitcoin: 1J3APoaFT2jcqRzpb8bEt2rwUn3mDpWE5U AutoName: MoneyWallet -Summary: Expense Manager Description: |- MoneyWallet is an advanced expense manager that allows you to track your expenses and plan budgets. You can organize your data using custom diff --git a/metadata/com.oriondev.moneywallet/en-US/summary.txt b/metadata/com.oriondev.moneywallet/en-US/summary.txt new file mode 100644 index 0000000000..82cdc3281d --- /dev/null +++ b/metadata/com.oriondev.moneywallet/en-US/summary.txt @@ -0,0 +1 @@ +Expense Manager diff --git a/metadata/com.osfans.trime.yml b/metadata/com.osfans.trime.yml index c83046d8a0..b290d5c907 100644 --- a/metadata/com.osfans.trime.yml +++ b/metadata/com.osfans.trime.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/osfans/trime/issues Donate: https://raw.githubusercontent.com/osfans/trime/develop/osfans_alipay.png AutoName: Trime -Summary: Chinese IME with Rime Input Method Engine RepoType: git Repo: https://github.com/osfans/trime diff --git a/metadata/com.osfans.trime/en-US/summary.txt b/metadata/com.osfans.trime/en-US/summary.txt new file mode 100644 index 0000000000..f337d0704d --- /dev/null +++ b/metadata/com.osfans.trime/en-US/summary.txt @@ -0,0 +1 @@ +Chinese IME with Rime Input Method Engine diff --git a/metadata/com.owncloud.android.yml b/metadata/com.owncloud.android.yml index 94dcdf2f77..4d347acb62 100644 --- a/metadata/com.owncloud.android.yml +++ b/metadata/com.owncloud.android.yml @@ -8,7 +8,6 @@ Changelog: https://github.com/owncloud/android/blob/HEAD/CHANGELOG.md Donate: https://www.bountysource.com/teams/owncloud AutoName: ownCloud -Summary: Synchronization client Description: |- ownCloud is a free software package you can install on a server to manage files, contacts, calendars, music, pictures and much more. This is the official Android diff --git a/metadata/com.owncloud.android/en-US/summary.txt b/metadata/com.owncloud.android/en-US/summary.txt new file mode 100644 index 0000000000..aae8dbc064 --- /dev/null +++ b/metadata/com.owncloud.android/en-US/summary.txt @@ -0,0 +1 @@ +Synchronization client diff --git a/metadata/com.quchen.flashcard.yml b/metadata/com.quchen.flashcard.yml index 0d168f863f..818e885592 100644 --- a/metadata/com.quchen.flashcard.yml +++ b/metadata/com.quchen.flashcard.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/cubei/flashcards IssueTracker: https://github.com/cubei/flashcards/issues AutoName: FlashCards -Summary: Simple flash card app with csv files as input Description: |- ''FlashCards'' is a simple flash card app with csv files as input. It is meant for stuff like learning vocabulary of different languages. diff --git a/metadata/com.quchen.flashcard/en-US/summary.txt b/metadata/com.quchen.flashcard/en-US/summary.txt new file mode 100644 index 0000000000..3f901d04aa --- /dev/null +++ b/metadata/com.quchen.flashcard/en-US/summary.txt @@ -0,0 +1 @@ +Simple flash card app with csv files as input diff --git a/metadata/com.rascarlo.adaptive.brightness.tile.yml b/metadata/com.rascarlo.adaptive.brightness.tile.yml index 4ecc48bfbd..1a15345287 100644 --- a/metadata/com.rascarlo.adaptive.brightness.tile.yml +++ b/metadata/com.rascarlo.adaptive.brightness.tile.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/rascarlo/AdaptiveBrightnessTile IssueTracker: https://github.com/rascarlo/AdaptiveBrightnessTile/issues AutoName: Adaptive Brightness Tile -Summary: Quick settings tile for adaptive brightness Description: |- ''Adaptive Brightness'' provides a tile that can be added to the ''Quick Settings'' layout in the notification panel to change diff --git a/metadata/com.rascarlo.adaptive.brightness.tile/en-US/summary.txt b/metadata/com.rascarlo.adaptive.brightness.tile/en-US/summary.txt new file mode 100644 index 0000000000..9e7bfd529e --- /dev/null +++ b/metadata/com.rascarlo.adaptive.brightness.tile/en-US/summary.txt @@ -0,0 +1 @@ +Quick settings tile for adaptive brightness diff --git a/metadata/com.sahdeepsingh.Bop.yml b/metadata/com.sahdeepsingh.Bop.yml index 49c767152f..bae3bb96f3 100644 --- a/metadata/com.sahdeepsingh.Bop.yml +++ b/metadata/com.sahdeepsingh.Bop.yml @@ -7,7 +7,6 @@ Changelog: https://github.com/iamSahdeep/Bop/blob/HEAD/changelog.md Donate: https://www.paypal.me/sahdeep AutoName: Bop-MusicPlayer -Summary: A light weight powerfull music player Description: |- A lightweight, powerful, fast and open source Music Player with elegant and stylish UI design, in just 5MB. This audio player supports almost all types audio or music formats. Easily play music by genres , albums , artists , songs. Music player was designed to bring better experience to user when they listen to music. It scans all music automatically and group them by title, artist, album, genre. Easy to find the song you want with search option. Supports audio equalizer to improves music sound, you can customize with own style. diff --git a/metadata/com.sahdeepsingh.Bop/en-US/summary.txt b/metadata/com.sahdeepsingh.Bop/en-US/summary.txt new file mode 100644 index 0000000000..7c2b79cb65 --- /dev/null +++ b/metadata/com.sahdeepsingh.Bop/en-US/summary.txt @@ -0,0 +1 @@ +A light weight powerfull music player diff --git a/metadata/com.samarthdesai.repeatme.yml b/metadata/com.samarthdesai.repeatme.yml index 8ca16c3bfb..26c5f175ed 100644 --- a/metadata/com.samarthdesai.repeatme.yml +++ b/metadata/com.samarthdesai.repeatme.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/SamarthDesai01/RepeatMe/issues Changelog: https://github.com/SamarthDesai01/RepeatMe/releases AutoName: Repeat Me -Summary: Schedule custom, interval based reminders Description: |- ''Repeat Me'' is the cleanest, fastest, and most customize-able way to schedule notifications on your phone. With no ads or any questionable permissions, diff --git a/metadata/com.samarthdesai.repeatme/en-US/summary.txt b/metadata/com.samarthdesai.repeatme/en-US/summary.txt new file mode 100644 index 0000000000..db29dd638b --- /dev/null +++ b/metadata/com.samarthdesai.repeatme/en-US/summary.txt @@ -0,0 +1 @@ +Schedule custom, interval based reminders diff --git a/metadata/com.scraperclub.android.yml b/metadata/com.scraperclub.android.yml index e4c36cc9de..a798d00ed8 100644 --- a/metadata/com.scraperclub.android.yml +++ b/metadata/com.scraperclub.android.yml @@ -7,7 +7,6 @@ WebSite: https://android.scraperclub.com SourceCode: https://github.com/Scraper-Club/Android-Scraper-Club IssueTracker: https://github.com/Scraper-Club/Android-Scraper-Club/issues -Summary: Application for ScraperClub Description: Scraper Club is a network of people who share their device while it is not in use, so they can use the power of the network when they need. diff --git a/metadata/com.scraperclub.android/en-US/summary.txt b/metadata/com.scraperclub.android/en-US/summary.txt new file mode 100644 index 0000000000..caa88b2058 --- /dev/null +++ b/metadata/com.scraperclub.android/en-US/summary.txt @@ -0,0 +1 @@ +Application for ScraperClub diff --git a/metadata/com.sduduzog.slimlauncher.yml b/metadata/com.sduduzog.slimlauncher.yml index 1f69541b32..f2f66fbbd3 100644 --- a/metadata/com.sduduzog.slimlauncher.yml +++ b/metadata/com.sduduzog.slimlauncher.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/sduduzog/slim-launcher IssueTracker: https://github.com/sduduzog/slim-launcher/issues AutoName: Slim Launcher -Summary: Minimalistic launcher Description: |- Slim launcher only allows you to use fewer apps on your phone. Giving you more time to enjoy life as it was intended. Also a perfect app for a minimalist lifestyle diff --git a/metadata/com.sduduzog.slimlauncher/en-US/summary.txt b/metadata/com.sduduzog.slimlauncher/en-US/summary.txt new file mode 100644 index 0000000000..c8eb11b31d --- /dev/null +++ b/metadata/com.sduduzog.slimlauncher/en-US/summary.txt @@ -0,0 +1 @@ +Minimalistic launcher diff --git a/metadata/com.simonramstedt.yoke.yml b/metadata/com.simonramstedt.yoke.yml index 9ca0c57840..bc5b7a8295 100644 --- a/metadata/com.simonramstedt.yoke.yml +++ b/metadata/com.simonramstedt.yoke.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/rmst/yoke-android/issues Changelog: https://github.com/rmst/yoke-android/releases AutoName: Yoke -Summary: Hackable gamepad for Linux Description: |- Yoke connects to a Linux computer via network (Wifi / Bluetooth / USB). It will be recognized as a normal Joystick/Gamepad by Linux, so it can be used diff --git a/metadata/com.simonramstedt.yoke/en-US/summary.txt b/metadata/com.simonramstedt.yoke/en-US/summary.txt new file mode 100644 index 0000000000..e253313139 --- /dev/null +++ b/metadata/com.simonramstedt.yoke/en-US/summary.txt @@ -0,0 +1 @@ +Hackable gamepad for Linux diff --git a/metadata/com.sovworks.edslite.yml b/metadata/com.sovworks.edslite.yml index 82b76c49f0..135475e5d4 100644 --- a/metadata/com.sovworks.edslite.yml +++ b/metadata/com.sovworks.edslite.yml @@ -8,7 +8,6 @@ SourceCode: https://github.com/sovworks/edslite IssueTracker: https://github.com/sovworks/edslite/issues Donate: https://sovworks.com/eds/donations.php -Summary: Virtual disk encryption Description: | EDS allows you to store your files in an encrypted container. diff --git a/metadata/com.sovworks.edslite/en-US/summary.txt b/metadata/com.sovworks.edslite/en-US/summary.txt new file mode 100644 index 0000000000..eb305877c3 --- /dev/null +++ b/metadata/com.sovworks.edslite/en-US/summary.txt @@ -0,0 +1 @@ +Virtual disk encryption diff --git a/metadata/com.stripe1.xmouse.yml b/metadata/com.stripe1.xmouse.yml index 59c80500c3..b4f60238f7 100644 --- a/metadata/com.stripe1.xmouse.yml +++ b/metadata/com.stripe1.xmouse.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/bradand/XMouse/issues Bitcoin: 17DaqbcEEG3Hn5jBv3sRjPTUUCW1eBp1Wg AutoName: XMouse -Summary: Remotely control X11 via SSH commands generated by your phone or tablet Description: |- Remotely control a Linux Box X11 display via SSH commands generated by your phone or tablet. Works well on the Raspberry Pi or any other Linux machine. diff --git a/metadata/com.stripe1.xmouse/en-US/summary.txt b/metadata/com.stripe1.xmouse/en-US/summary.txt new file mode 100644 index 0000000000..c7352f3cbf --- /dev/null +++ b/metadata/com.stripe1.xmouse/en-US/summary.txt @@ -0,0 +1 @@ +Remotely control X11 via SSH commands generated by your phone or tablet diff --git a/metadata/com.suyashsrijan.forcedoze.yml b/metadata/com.suyashsrijan.forcedoze.yml index 886ad405df..88d7f34ccf 100644 --- a/metadata/com.suyashsrijan.forcedoze.yml +++ b/metadata/com.suyashsrijan.forcedoze.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/theblixguy/ForceDoze IssueTracker: https://github.com/theblixguy/ForceDoze/issues AutoName: ForceDoze -Summary: Enable Doze mode immediately after screen off and turn off motion sensing Description: |- '''ForceDoze''' allows you to forcefully enable Doze right after you turn off your screen, and on top of that, it also disables motion sensors so Doze stays active diff --git a/metadata/com.suyashsrijan.forcedoze/en-US/summary.txt b/metadata/com.suyashsrijan.forcedoze/en-US/summary.txt new file mode 100644 index 0000000000..0b4bf29107 --- /dev/null +++ b/metadata/com.suyashsrijan.forcedoze/en-US/summary.txt @@ -0,0 +1 @@ +Enable Doze mode immediately after screen off and turn off motion sensing diff --git a/metadata/com.tananaev.calculator.yml b/metadata/com.tananaev.calculator.yml index 14d83140f1..b63cd3a999 100644 --- a/metadata/com.tananaev.calculator.yml +++ b/metadata/com.tananaev.calculator.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/tananaev/calculator-notification IssueTracker: https://github.com/tananaev/calculator-notification/issues AutoName: Calculator Notification -Summary: Calculator application in the Android notification drawer Description: |- How many times did you want to use calculator without suspending the app that you are currently using? Now it's possible with Calculator application in the notification area. diff --git a/metadata/com.tananaev.calculator/en-US/summary.txt b/metadata/com.tananaev.calculator/en-US/summary.txt new file mode 100644 index 0000000000..782788698a --- /dev/null +++ b/metadata/com.tananaev.calculator/en-US/summary.txt @@ -0,0 +1 @@ +Calculator application in the Android notification drawer diff --git a/metadata/com.thermatk.android.xf.fakegapps.yml b/metadata/com.thermatk.android.xf.fakegapps.yml index a8810009e3..3121997576 100644 --- a/metadata/com.thermatk.android.xf.fakegapps.yml +++ b/metadata/com.thermatk.android.xf.fakegapps.yml @@ -7,7 +7,6 @@ Changelog: https://github.com/thermatk/FakeGApps/releases LiberapayID: '27901' AutoName: FakeGapps -Summary: Used with µg GmsCore to enable Google Cloud Messaging (GCM) and more Description: |- '''XPosed Module''', get [[de.robv.android.xposed.installer]]. diff --git a/metadata/com.thermatk.android.xf.fakegapps/en-US/summary.txt b/metadata/com.thermatk.android.xf.fakegapps/en-US/summary.txt new file mode 100644 index 0000000000..e5f90c8cd9 --- /dev/null +++ b/metadata/com.thermatk.android.xf.fakegapps/en-US/summary.txt @@ -0,0 +1 @@ +Used with µg GmsCore to enable Google Cloud Messaging (GCM) and more diff --git a/metadata/com.thirtydegreesray.openhub.yml b/metadata/com.thirtydegreesray.openhub.yml index cf09d0065d..87e5d646ef 100644 --- a/metadata/com.thirtydegreesray.openhub.yml +++ b/metadata/com.thirtydegreesray.openhub.yml @@ -5,7 +5,6 @@ WebSite: https://thirtydegreesray.github.io/OpenHub/ SourceCode: https://github.com/ThirtyDegreesRay/OpenHub IssueTracker: https://github.com/ThirtyDegreesRay/OpenHub/issues -Summary: A GitHub client app, faster and concise Description: |- An open source GitHub Android client app, faster and concise. diff --git a/metadata/com.thirtydegreesray.openhub/en-US/summary.txt b/metadata/com.thirtydegreesray.openhub/en-US/summary.txt new file mode 100644 index 0000000000..4b9bc2058f --- /dev/null +++ b/metadata/com.thirtydegreesray.openhub/en-US/summary.txt @@ -0,0 +1 @@ +A GitHub client app, faster and concise diff --git a/metadata/com.tht.k3pler.yml b/metadata/com.tht.k3pler.yml index 6138cb38d3..a2bec6bb5e 100644 --- a/metadata/com.tht.k3pler.yml +++ b/metadata/com.tht.k3pler.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/KeyLo99/k3pler IssueTracker: https://github.com/KeyLo99/k3pler/issues AutoName: k3pler -Summary: Network connection blocker and packet analyzer Description: |- ''k3pler'' is a network connection blocker and packet analyzer built on top of local HTTP proxy. It offers a.o. the following features: diff --git a/metadata/com.tht.k3pler/en-US/summary.txt b/metadata/com.tht.k3pler/en-US/summary.txt new file mode 100644 index 0000000000..a791c63b64 --- /dev/null +++ b/metadata/com.tht.k3pler/en-US/summary.txt @@ -0,0 +1 @@ +Network connection blocker and packet analyzer diff --git a/metadata/com.tobykurien.webmediashare.yml b/metadata/com.tobykurien.webmediashare.yml index d01b385423..40d3f8dd5e 100644 --- a/metadata/com.tobykurien.webmediashare.yml +++ b/metadata/com.tobykurien.webmediashare.yml @@ -8,7 +8,6 @@ IssueTracker: https://github.com/tobykurien/WebMediaShare/issues Changelog: https://github.com/tobykurien/WebMediaShare/releases AutoName: Web Media Share -Summary: Browser for viewing, sharing, or casting media from websites Description: | WebMediaShare is an app to browse your favourite media websites (e.g. online streaming sites, online radio stations, etc.) so that you can: diff --git a/metadata/com.tobykurien.webmediashare/en-US/summary.txt b/metadata/com.tobykurien.webmediashare/en-US/summary.txt new file mode 100644 index 0000000000..5ee4cb856a --- /dev/null +++ b/metadata/com.tobykurien.webmediashare/en-US/summary.txt @@ -0,0 +1 @@ +Browser for viewing, sharing, or casting media from websites diff --git a/metadata/com.ulicae.cinelog.yml b/metadata/com.ulicae.cinelog.yml index 207ab1f692..c4b54a785d 100644 --- a/metadata/com.ulicae.cinelog.yml +++ b/metadata/com.ulicae.cinelog.yml @@ -8,7 +8,6 @@ SourceCode: https://github.com/Alcidauk/CineLog IssueTracker: https://github.com/Alcidauk/CineLog/issues AutoName: CineLog -Summary: Save reviews of movies Description: Search for films with [https://www.themoviedb.org/ tmdb.org] API. Save them to your local database. Add review and rating to watched films. Rate and review films that does not exist in tmdb too. diff --git a/metadata/com.ulicae.cinelog/en-US/summary.txt b/metadata/com.ulicae.cinelog/en-US/summary.txt new file mode 100644 index 0000000000..76c1128e36 --- /dev/null +++ b/metadata/com.ulicae.cinelog/en-US/summary.txt @@ -0,0 +1 @@ +Save reviews of movies diff --git a/metadata/com.wangdaye.mysplash.yml b/metadata/com.wangdaye.mysplash.yml index 23f678ef47..7fbc32e53f 100644 --- a/metadata/com.wangdaye.mysplash.yml +++ b/metadata/com.wangdaye.mysplash.yml @@ -8,7 +8,6 @@ IssueTracker: https://github.com/WangDaYeeeeee/Mysplash/issues Changelog: https://github.com/WangDaYeeeeee/Mysplash/releases AutoName: Mysplash -Summary: View stream of high resolution images Description: |- A lightweight client for [https://unsplash.com/ Unsplash] with following features: diff --git a/metadata/com.wangdaye.mysplash/en-US/summary.txt b/metadata/com.wangdaye.mysplash/en-US/summary.txt new file mode 100644 index 0000000000..ec7bb6a09e --- /dev/null +++ b/metadata/com.wangdaye.mysplash/en-US/summary.txt @@ -0,0 +1 @@ +View stream of high resolution images diff --git a/metadata/com.wownero.wownerujo.yml b/metadata/com.wownero.wownerujo.yml index dc96ef2406..186ea19001 100644 --- a/metadata/com.wownero.wownerujo.yml +++ b/metadata/com.wownero.wownerujo.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/wownero/wownerujo/ IssueTracker: https://github.com/wownero/wownerujo//issues AutoName: Wownerujo -Summary: Wownero wallet Description: |- Wownero is a fork of the cryptocurrency Monero with primary alterations. diff --git a/metadata/com.wownero.wownerujo/en-US/summary.txt b/metadata/com.wownero.wownerujo/en-US/summary.txt new file mode 100644 index 0000000000..aa09ccb9c4 --- /dev/null +++ b/metadata/com.wownero.wownerujo/en-US/summary.txt @@ -0,0 +1 @@ +Wownero wallet diff --git a/metadata/com.zzzmode.appopsx.yml b/metadata/com.zzzmode.appopsx.yml index dc1dbd68bf..7032ae978d 100644 --- a/metadata/com.zzzmode.appopsx.yml +++ b/metadata/com.zzzmode.appopsx.yml @@ -4,7 +4,6 @@ License: MIT SourceCode: https://github.com/8enet/AppOpsX IssueTracker: https://github.com/8enet/AppOpsX/issues -Summary: A front-end for the AppOpsService Description: AppOpsX is a front-end application for the Android AppOpsService. It allows you to restrict app permissions. diff --git a/metadata/com.zzzmode.appopsx/en-US/summary.txt b/metadata/com.zzzmode.appopsx/en-US/summary.txt new file mode 100644 index 0000000000..64645494ca --- /dev/null +++ b/metadata/com.zzzmode.appopsx/en-US/summary.txt @@ -0,0 +1 @@ +A front-end for the AppOpsService diff --git a/metadata/community.fairphone.checkup.yml b/metadata/community.fairphone.checkup.yml index 0f5eaf53cf..ef46a4e526 100644 --- a/metadata/community.fairphone.checkup.yml +++ b/metadata/community.fairphone.checkup.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/WeAreFairphone/FP2-Checkup IssueTracker: https://github.com/WeAreFairphone/FP2-Checkup/issues AutoName: Fairphone Checkup -Summary: An app that allows end users to test the features of their device Description: |- This is a fork of the Fairphone 2 checkup app that has been modified in order to work on other devices as well. diff --git a/metadata/community.fairphone.checkup/en-US/summary.txt b/metadata/community.fairphone.checkup/en-US/summary.txt new file mode 100644 index 0000000000..d5c4e50b05 --- /dev/null +++ b/metadata/community.fairphone.checkup/en-US/summary.txt @@ -0,0 +1 @@ +An app that allows end users to test the features of their device diff --git a/metadata/community.peers.internetradio.yml b/metadata/community.peers.internetradio.yml index e55c1b22bb..1d9d007848 100644 --- a/metadata/community.peers.internetradio.yml +++ b/metadata/community.peers.internetradio.yml @@ -7,7 +7,6 @@ SourceCode: https://notabug.org/zplus/InternetRadio IssueTracker: https://notabug.org/zplus/InternetRadio/issues AutoName: Internet Radio -Summary: Listen to Internet radio stations Description: | This is a small app to search Internet radio stations, and listen to them. diff --git a/metadata/community.peers.internetradio/en-US/summary.txt b/metadata/community.peers.internetradio/en-US/summary.txt new file mode 100644 index 0000000000..119ff81ba2 --- /dev/null +++ b/metadata/community.peers.internetradio/en-US/summary.txt @@ -0,0 +1 @@ +Listen to Internet radio stations diff --git a/metadata/cz.dvratil.fbeventsync.yml b/metadata/cz.dvratil.fbeventsync.yml index 47a5c224fd..2f0fe6c554 100644 --- a/metadata/cz.dvratil.fbeventsync.yml +++ b/metadata/cz.dvratil.fbeventsync.yml @@ -8,7 +8,6 @@ SourceCode: https://github.com/danvratil/FBEventSync IssueTracker: https://github.com/danvratil/FBEventSync/issues AutoName: Event Sync for Facebook -Summary: Sync your Facebook Events into your calendar Description: |- '''Event Sync for Facebook''' is an app that will sync your Facebook events to your calendar. It will create five new calendars: diff --git a/metadata/cz.dvratil.fbeventsync/en-US/summary.txt b/metadata/cz.dvratil.fbeventsync/en-US/summary.txt new file mode 100644 index 0000000000..2a2c918293 --- /dev/null +++ b/metadata/cz.dvratil.fbeventsync/en-US/summary.txt @@ -0,0 +1 @@ +Sync your Facebook Events into your calendar diff --git a/metadata/cz.harvie.northdog.yml b/metadata/cz.harvie.northdog.yml index 7c5e12a830..277b36786a 100644 --- a/metadata/cz.harvie.northdog.yml +++ b/metadata/cz.harvie.northdog.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/Harvie/NorthDog IssueTracker: https://github.com/Harvie/NorthDog/issues AutoName: NorthDog Audio Compass -Summary: 3D Audio Compass Description: |- This will play 3D sound so that it will appear to come from north. Can be used by blind people and for various other reasons. Stereo headphones required. diff --git a/metadata/cz.harvie.northdog/en-US/summary.txt b/metadata/cz.harvie.northdog/en-US/summary.txt new file mode 100644 index 0000000000..94025650e5 --- /dev/null +++ b/metadata/cz.harvie.northdog/en-US/summary.txt @@ -0,0 +1 @@ +3D Audio Compass diff --git a/metadata/d.d.meshenger.yml b/metadata/d.d.meshenger.yml index f55d6f367f..e08e5be47a 100644 --- a/metadata/d.d.meshenger.yml +++ b/metadata/d.d.meshenger.yml @@ -9,7 +9,6 @@ SourceCode: https://github.com/dakhnod/Meshenger IssueTracker: https://github.com/dakhnod/Meshenger/issues AutoName: Meshenger -Summary: An Open-Source P2P Messenger Description: | This app allows voice- and videocommunication without any server or Internet access. Simply scan each others contact QR-Code and call each other. This works on most networks such as community networks or even company networks. diff --git a/metadata/d.d.meshenger/en-US/summary.txt b/metadata/d.d.meshenger/en-US/summary.txt new file mode 100644 index 0000000000..4bc93d8195 --- /dev/null +++ b/metadata/d.d.meshenger/en-US/summary.txt @@ -0,0 +1 @@ +An Open-Source P2P Messenger diff --git a/metadata/de.antonarnold.android.xoverrideheadphonejackdetection.yml b/metadata/de.antonarnold.android.xoverrideheadphonejackdetection.yml index 28fa7d90c1..65250e3e88 100644 --- a/metadata/de.antonarnold.android.xoverrideheadphonejackdetection.yml +++ b/metadata/de.antonarnold.android.xoverrideheadphonejackdetection.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/anton-arnold/xoverrideheadphonejackdetection IssueTracker: https://github.com/anton-arnold/xoverrideheadphonejackdetection/issues AutoName: XOverrideHeadphoneJackDetection -Summary: Manually override the headphone jack detection Description: | This XPosed module allows you to manually override the headphone jack detection of an Android device. diff --git a/metadata/de.antonarnold.android.xoverrideheadphonejackdetection/en-US/summary.txt b/metadata/de.antonarnold.android.xoverrideheadphonejackdetection/en-US/summary.txt new file mode 100644 index 0000000000..4062bb55ed --- /dev/null +++ b/metadata/de.antonarnold.android.xoverrideheadphonejackdetection/en-US/summary.txt @@ -0,0 +1 @@ +Manually override the headphone jack detection diff --git a/metadata/de.binary_kitchen.doorlock_app.yml b/metadata/de.binary_kitchen.doorlock_app.yml index ece96c0efe..daf5b30cd0 100644 --- a/metadata/de.binary_kitchen.doorlock_app.yml +++ b/metadata/de.binary_kitchen.doorlock_app.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/binary-kitchen/doorlock-app IssueTracker: https://github.com/binary-kitchen/doorlock-app/issues AutoName: Binary Kitchen Doorlock -Summary: Binary Kitchen's Open Sesame Description: | "We are proud to present the next generation of the revolutionary way to unlock the door of the Binary Kitchen hackspace. diff --git a/metadata/de.binary_kitchen.doorlock_app/en-US/summary.txt b/metadata/de.binary_kitchen.doorlock_app/en-US/summary.txt new file mode 100644 index 0000000000..40df3d91cc --- /dev/null +++ b/metadata/de.binary_kitchen.doorlock_app/en-US/summary.txt @@ -0,0 +1 @@ +Binary Kitchen's Open Sesame diff --git a/metadata/de.blau.android.yml b/metadata/de.blau.android.yml index b19498c011..448e96722e 100644 --- a/metadata/de.blau.android.yml +++ b/metadata/de.blau.android.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/MarcusWolschon/osmeditor4android/issues Changelog: https://github.com/MarcusWolschon/osmeditor4android/blob/HEAD/CHANGELOG.txt AutoName: Vespucci -Summary: OpenStreetMap editor Description: |- * Create and edit new Nodes and Ways * Append Nodes to existing Ways diff --git a/metadata/de.blau.android/en-US/summary.txt b/metadata/de.blau.android/en-US/summary.txt new file mode 100644 index 0000000000..145558da6d --- /dev/null +++ b/metadata/de.blau.android/en-US/summary.txt @@ -0,0 +1 @@ +OpenStreetMap editor diff --git a/metadata/de.blocklink.pigrid.yml b/metadata/de.blocklink.pigrid.yml index d3874bcde7..ade3352f48 100644 --- a/metadata/de.blocklink.pigrid.yml +++ b/metadata/de.blocklink.pigrid.yml @@ -9,7 +9,6 @@ SourceCode: https://github.com/blocklink-it/pigrid-companion-app IssueTracker: https://github.com/blocklink-it/pigrid-companion-app/issues AutoName: PiGrid Companion -Summary: Gridcoin Stakebox Companion App Description: |- The PiGrid Companion app allows you to find and control your PiGrid device/s easily and comfortably via your Smartphone or Tablet. diff --git a/metadata/de.blocklink.pigrid/en-US/summary.txt b/metadata/de.blocklink.pigrid/en-US/summary.txt new file mode 100644 index 0000000000..22eb8c1ce2 --- /dev/null +++ b/metadata/de.blocklink.pigrid/en-US/summary.txt @@ -0,0 +1 @@ +Gridcoin Stakebox Companion App diff --git a/metadata/de.c3nav.droid.yml b/metadata/de.c3nav.droid.yml index 0109c084a2..d4b643f3df 100644 --- a/metadata/de.c3nav.droid.yml +++ b/metadata/de.c3nav.droid.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/c3nav/c3nav-android/ IssueTracker: https://github.com/c3nav/c3nav-android/issues AutoName: c3nav -Summary: Navigation in C3 events Description: |- This is the official Android app for c3nav, the map & indoor navigation software at the Chaos Communication Congress which you can find at [https://c3nav.de diff --git a/metadata/de.c3nav.droid/en-US/summary.txt b/metadata/de.c3nav.droid/en-US/summary.txt new file mode 100644 index 0000000000..e926813c69 --- /dev/null +++ b/metadata/de.c3nav.droid/en-US/summary.txt @@ -0,0 +1 @@ +Navigation in C3 events diff --git a/metadata/de.democracydeutschland.app.yml b/metadata/de.democracydeutschland.app.yml index 9fe3237186..b0b9404f23 100644 --- a/metadata/de.democracydeutschland.app.yml +++ b/metadata/de.democracydeutschland.app.yml @@ -9,7 +9,6 @@ IssueTracker: https://github.com/demokratie-live/democracy-client/issues Changelog: https://github.com/demokratie-live/democracy-client/blob/HEAD/CHANGELOG.md AutoName: DEMOCRACY -Summary: Dein virtuelles Bundestagsmandat Description: |- Dein Bundestagsmandat ist da – einfach, schnell, sicher. diff --git a/metadata/de.democracydeutschland.app/en-US/summary.txt b/metadata/de.democracydeutschland.app/en-US/summary.txt new file mode 100644 index 0000000000..0b448389ef --- /dev/null +++ b/metadata/de.democracydeutschland.app/en-US/summary.txt @@ -0,0 +1 @@ +Dein virtuelles Bundestagsmandat diff --git a/metadata/de.digisocken.stop_o_moto.yml b/metadata/de.digisocken.stop_o_moto.yml index be512f0b0c..2c99f4efd3 100644 --- a/metadata/de.digisocken.stop_o_moto.yml +++ b/metadata/de.digisocken.stop_o_moto.yml @@ -6,7 +6,6 @@ SourceCode: https://gitlab.com/deadlockz/caputhown IssueTracker: https://gitlab.com/deadlockz/caputhown/issues AutoName: Stop-o-Moto -Summary: Make gif and video files by taking single pictures Description: | This simple app creates videos (MP4) and GIF files from several camera shots and stores them under ''Documents/de.digisocken.stop-o-moto/'' on your device. diff --git a/metadata/de.digisocken.stop_o_moto/en-US/summary.txt b/metadata/de.digisocken.stop_o_moto/en-US/summary.txt new file mode 100644 index 0000000000..d30cd9a652 --- /dev/null +++ b/metadata/de.digisocken.stop_o_moto/en-US/summary.txt @@ -0,0 +1 @@ +Make gif and video files by taking single pictures diff --git a/metadata/de.drhoffmannsoftware.calcvac.yml b/metadata/de.drhoffmannsoftware.calcvac.yml index 21e57f2dd5..921830257d 100644 --- a/metadata/de.drhoffmannsoftware.calcvac.yml +++ b/metadata/de.drhoffmannsoftware.calcvac.yml @@ -6,7 +6,6 @@ IssueTracker: https://gitlab.com/kollo/Calcvac-Android/issues Changelog: https://gitlab.com/kollo/Calcvac-Android/blob/HEAD/CHANGELOG AutoName: Calcvac -Summary: Calculate logitudinal one-dimensional pressure profiles in vacuum pipes Description: |- The programs calcvac/vacline can calculate logitudinal one-dimensional pressure profiles in vacuum pipes. The pipes can consist of different diff --git a/metadata/de.drhoffmannsoftware.calcvac/en-US/summary.txt b/metadata/de.drhoffmannsoftware.calcvac/en-US/summary.txt new file mode 100644 index 0000000000..7f1638ac25 --- /dev/null +++ b/metadata/de.drhoffmannsoftware.calcvac/en-US/summary.txt @@ -0,0 +1 @@ +Calculate logitudinal one-dimensional pressure profiles in vacuum pipes diff --git a/metadata/de.freifunk_karte.freifunk_karte.yml b/metadata/de.freifunk_karte.freifunk_karte.yml index 7d32090ab6..f672441636 100644 --- a/metadata/de.freifunk_karte.freifunk_karte.yml +++ b/metadata/de.freifunk_karte.freifunk_karte.yml @@ -7,7 +7,6 @@ SourceCode: https://gitlab.com/TheRMaverick/Freifunk-Karte IssueTracker: https://gitlab.com/TheRMaverick/Freifunk-Karte/issues AutoName: Freifunk-Karte -Summary: Map for viewing the Freifunk Nodes on a OpenStreetMap Description: |- You need free WiFi on your road? This app is for you. It shows the Freifunk Nodes on a OpenStreetMap. Go to it and connect. That's it. No contract, no diff --git a/metadata/de.freifunk_karte.freifunk_karte/en-US/summary.txt b/metadata/de.freifunk_karte.freifunk_karte/en-US/summary.txt new file mode 100644 index 0000000000..b6d9daf284 --- /dev/null +++ b/metadata/de.freifunk_karte.freifunk_karte/en-US/summary.txt @@ -0,0 +1 @@ +Map for viewing the Freifunk Nodes on a OpenStreetMap diff --git a/metadata/de.fzi.bettyrieckmann.quotingstars.yml b/metadata/de.fzi.bettyrieckmann.quotingstars.yml index ea1dff49c3..ac91acdfcb 100644 --- a/metadata/de.fzi.bettyrieckmann.quotingstars.yml +++ b/metadata/de.fzi.bettyrieckmann.quotingstars.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/uheai/Quoting-Stars IssueTracker: https://github.com/uheai/Quoting-Stars/issues AutoName: Quoting Stars -Summary: App for Silent Communications 2017 RepoType: git Repo: https://github.com/uheai/Quoting-Stars diff --git a/metadata/de.fzi.bettyrieckmann.quotingstars/en-US/summary.txt b/metadata/de.fzi.bettyrieckmann.quotingstars/en-US/summary.txt new file mode 100644 index 0000000000..7fbbfd7e1e --- /dev/null +++ b/metadata/de.fzi.bettyrieckmann.quotingstars/en-US/summary.txt @@ -0,0 +1 @@ +App for Silent Communications 2017 diff --git a/metadata/de.hu_berlin.eduroam.yml b/metadata/de.hu_berlin.eduroam.yml index 92aeb4d417..e6c31dece1 100644 --- a/metadata/de.hu_berlin.eduroam.yml +++ b/metadata/de.hu_berlin.eduroam.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/hu-berlin-cms/hu-eduroam IssueTracker: https://github.com/hu-berlin-cms/hu-eduroam/issues AutoName: HU Berlin Wi-Fi Installer -Summary: Eduroam setup tool for Humboldt University of Berlin Description: |- With this app members of Humboldt University Berlin (everyone who has a Computer- and Media service (CMS) account) can create a WiFi profile for diff --git a/metadata/de.hu_berlin.eduroam/en-US/summary.txt b/metadata/de.hu_berlin.eduroam/en-US/summary.txt new file mode 100644 index 0000000000..40bf955ac6 --- /dev/null +++ b/metadata/de.hu_berlin.eduroam/en-US/summary.txt @@ -0,0 +1 @@ +Eduroam setup tool for Humboldt University of Berlin diff --git a/metadata/de.igloffstein.maik.aRevelation.yml b/metadata/de.igloffstein.maik.aRevelation.yml index 837a72ec28..98ed64859e 100644 --- a/metadata/de.igloffstein.maik.aRevelation.yml +++ b/metadata/de.igloffstein.maik.aRevelation.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/OldSparkyMI/aRevelation/issues Changelog: https://github.com/OldSparkyMI/aRevelation/releases AutoName: aRevelation -Summary: password manager based on Revelation Password Manager file format Description: |- ''aRevelation'' is an Android password manager based on [https://revelation.olasagasti.info/ Revelation] Password Manager file diff --git a/metadata/de.igloffstein.maik.aRevelation/en-US/summary.txt b/metadata/de.igloffstein.maik.aRevelation/en-US/summary.txt new file mode 100644 index 0000000000..f6782bba44 --- /dev/null +++ b/metadata/de.igloffstein.maik.aRevelation/en-US/summary.txt @@ -0,0 +1 @@ +password manager based on Revelation Password Manager file format diff --git a/metadata/de.kromke.andreas.mediascanner.yml b/metadata/de.kromke.andreas.mediascanner.yml index 663c4c721b..a0abbc0f0b 100644 --- a/metadata/de.kromke.andreas.mediascanner.yml +++ b/metadata/de.kromke.andreas.mediascanner.yml @@ -7,7 +7,6 @@ IssueTracker: https://gitlab.com/AndreasK/mediascanner/issues Changelog: https://gitlab.com/AndreasK/mediascanner/blob/HEAD/app/src/main/assets/version-history.txt AutoName: Classical Music Scanner -Summary: Auxiliary program for the Unpopular Music Player and Opus 1 Music Player Description: |- Scans the device for local audio files and builds a database to be used by Unpopular Music Player or Opus 1 Music Player. Contrary to the Android service it diff --git a/metadata/de.kromke.andreas.mediascanner/en-US/summary.txt b/metadata/de.kromke.andreas.mediascanner/en-US/summary.txt new file mode 100644 index 0000000000..5165e72b22 --- /dev/null +++ b/metadata/de.kromke.andreas.mediascanner/en-US/summary.txt @@ -0,0 +1 @@ +Auxiliary program for the Unpopular Music Player and Opus 1 Music Player diff --git a/metadata/de.kromke.andreas.musictagger.yml b/metadata/de.kromke.andreas.musictagger.yml index 5a90cda8c9..b833422b8e 100644 --- a/metadata/de.kromke.andreas.musictagger.yml +++ b/metadata/de.kromke.andreas.musictagger.yml @@ -7,7 +7,6 @@ IssueTracker: https://gitlab.com/AndreasK/classical-music-tagger/issues Changelog: https://gitlab.com/AndreasK/classical-music-tagger/blob/HEAD/app/src/main/assets/version-history.txt AutoName: Classical Music Tagger -Summary: A plain audio file metadata editor especially for classical music Description: |- While most Android applications not even know about composers, this one additionally handles works, movements, conductors etc. diff --git a/metadata/de.kromke.andreas.musictagger/en-US/summary.txt b/metadata/de.kromke.andreas.musictagger/en-US/summary.txt new file mode 100644 index 0000000000..aeb75a6069 --- /dev/null +++ b/metadata/de.kromke.andreas.musictagger/en-US/summary.txt @@ -0,0 +1 @@ +A plain audio file metadata editor especially for classical music diff --git a/metadata/de.larcado.sesam.yml b/metadata/de.larcado.sesam.yml index 50005be15c..63f61f7b34 100644 --- a/metadata/de.larcado.sesam.yml +++ b/metadata/de.larcado.sesam.yml @@ -7,7 +7,6 @@ IssueTracker: https://gitlab.com/larcado/sesam/issues Changelog: https://gitlab.com/larcado/sesam/blob/HEAD/CHANGELOG AutoName: sesam -Summary: Hash based password manager Description: A password manager app that does not store the passwords but only generates them based on a salted hash function (PBKDF2WithHmacSHA1). diff --git a/metadata/de.larcado.sesam/en-US/summary.txt b/metadata/de.larcado.sesam/en-US/summary.txt new file mode 100644 index 0000000000..9af7dee3cf --- /dev/null +++ b/metadata/de.larcado.sesam/en-US/summary.txt @@ -0,0 +1 @@ +Hash based password manager diff --git a/metadata/de.markusfisch.android.binaryeye.yml b/metadata/de.markusfisch.android.binaryeye.yml index 3eb90bd363..e02ac3fe29 100644 --- a/metadata/de.markusfisch.android.binaryeye.yml +++ b/metadata/de.markusfisch.android.binaryeye.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/markusfisch/BinaryEye IssueTracker: https://github.com/markusfisch/BinaryEye/issues AutoName: Binary Eye -Summary: Yet another barcode scanner Description: |- ''Binary Eye'' works in portrait and landscape orientation, can read inverted codes, is Material Design and doesn't do anything else but diff --git a/metadata/de.markusfisch.android.binaryeye/en-US/summary.txt b/metadata/de.markusfisch.android.binaryeye/en-US/summary.txt new file mode 100644 index 0000000000..bc4b13df0b --- /dev/null +++ b/metadata/de.markusfisch.android.binaryeye/en-US/summary.txt @@ -0,0 +1 @@ +Yet another barcode scanner diff --git a/metadata/de.micmun.android.deufeitage.yml b/metadata/de.micmun.android.deufeitage.yml index a4ded0f6e3..4abeb5def4 100644 --- a/metadata/de.micmun.android.deufeitage.yml +++ b/metadata/de.micmun.android.deufeitage.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/MicMun/DeuFeiTage/issues Changelog: https://github.com/MicMun/DeuFeiTage/blob/HEAD/Changelog.md AutoName: DeuFeiTage -Summary: Find the German public holidays per state and year Description: |- Find the date of a public holiday for this or another year. diff --git a/metadata/de.micmun.android.deufeitage/en-US/summary.txt b/metadata/de.micmun.android.deufeitage/en-US/summary.txt new file mode 100644 index 0000000000..066919912b --- /dev/null +++ b/metadata/de.micmun.android.deufeitage/en-US/summary.txt @@ -0,0 +1 @@ +Find the German public holidays per state and year diff --git a/metadata/de.nodomain.tobihille.seniorlauncher.yml b/metadata/de.nodomain.tobihille.seniorlauncher.yml index 555387cb77..72c1cb7eaf 100644 --- a/metadata/de.nodomain.tobihille.seniorlauncher.yml +++ b/metadata/de.nodomain.tobihille.seniorlauncher.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/tobihille/SeniorLauncher/issues Changelog: https://github.com/tobihille/SeniorLauncher/releases AutoName: Senior Launcher -Summary: A launcher app intended for oldies Description: |- What does this app do? * It registers as app launcher (that means it is called when the phone boots and the home button is pressed). diff --git a/metadata/de.nodomain.tobihille.seniorlauncher/en-US/summary.txt b/metadata/de.nodomain.tobihille.seniorlauncher/en-US/summary.txt new file mode 100644 index 0000000000..29263e8dc6 --- /dev/null +++ b/metadata/de.nodomain.tobihille.seniorlauncher/en-US/summary.txt @@ -0,0 +1 @@ +A launcher app intended for oldies diff --git a/metadata/de.php_tech.piggybudget.yml b/metadata/de.php_tech.piggybudget.yml index 17ecc77152..fdfbeb3f66 100644 --- a/metadata/de.php_tech.piggybudget.yml +++ b/metadata/de.php_tech.piggybudget.yml @@ -7,7 +7,6 @@ Changelog: https://github.com/pmiddend/piggybudget/releases Donate: https://paypal.me/PhilippMiddendorf AutoName: piggybudget -Summary: Easily track your expenses Description: |- piggybudget is a very simple app to track your expenses. In short bullet points: diff --git a/metadata/de.php_tech.piggybudget/en-US/summary.txt b/metadata/de.php_tech.piggybudget/en-US/summary.txt new file mode 100644 index 0000000000..2b79980dcb --- /dev/null +++ b/metadata/de.php_tech.piggybudget/en-US/summary.txt @@ -0,0 +1 @@ +Easily track your expenses diff --git a/metadata/de.r4md4c.gamedealz.yml b/metadata/de.r4md4c.gamedealz.yml index 52dcd8bf59..5e7e6918e4 100644 --- a/metadata/de.r4md4c.gamedealz.yml +++ b/metadata/de.r4md4c.gamedealz.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/R4md4c/GameDealz IssueTracker: https://github.com/R4md4c/GameDealz/issues AutoName: GameDealz -Summary: A non-official client for IsThereAnyDeal.com Description: |- GameDealz is a non-official client for the game price comparison website [http://isthereanydeal.com IsThereAnyDeal.com]. diff --git a/metadata/de.r4md4c.gamedealz/en-US/summary.txt b/metadata/de.r4md4c.gamedealz/en-US/summary.txt new file mode 100644 index 0000000000..73e9a1fb00 --- /dev/null +++ b/metadata/de.r4md4c.gamedealz/en-US/summary.txt @@ -0,0 +1 @@ +A non-official client for IsThereAnyDeal.com diff --git a/metadata/de.spiritcroc.darkcroc.substratum.yml b/metadata/de.spiritcroc.darkcroc.substratum.yml index bcd36bcdc7..6e10b8b7e6 100644 --- a/metadata/de.spiritcroc.darkcroc.substratum.yml +++ b/metadata/de.spiritcroc.darkcroc.substratum.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/SpiritCroc/DarkCroc-Android-theme/issues Changelog: https://github.com/SpiritCroc/DarkCroc-Android-theme/releases AutoName: DarkCroc Theme -Summary: A dark Substratum theme targeting Android 9+ Description: |- '''IMPORTANT:''' You need the Substratum theming platform working on your device! Read the inbuilt information before reporting any issues! diff --git a/metadata/de.spiritcroc.darkcroc.substratum/en-US/summary.txt b/metadata/de.spiritcroc.darkcroc.substratum/en-US/summary.txt new file mode 100644 index 0000000000..3d850d612d --- /dev/null +++ b/metadata/de.spiritcroc.darkcroc.substratum/en-US/summary.txt @@ -0,0 +1 @@ +A dark Substratum theme targeting Android 9+ diff --git a/metadata/de.spiritcroc.defaultdarktheme_oms.yml b/metadata/de.spiritcroc.defaultdarktheme_oms.yml index 40a2e605cb..abb3a89685 100644 --- a/metadata/de.spiritcroc.defaultdarktheme_oms.yml +++ b/metadata/de.spiritcroc.defaultdarktheme_oms.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/SpiritCroc/DefaultDarkTheme-oms/issues Changelog: https://github.com/SpiritCroc/DefaultDarkTheme-oms/releases AutoName: Default Dark Theme -Summary: A dark Substratum theme targeting Android 7 & 8 Description: |- '''IMPORTANT:''' You need the Substratum theming platform working on your device! Read the inbuilt information before reporting any issues! diff --git a/metadata/de.spiritcroc.defaultdarktheme_oms/en-US/summary.txt b/metadata/de.spiritcroc.defaultdarktheme_oms/en-US/summary.txt new file mode 100644 index 0000000000..c812ada3be --- /dev/null +++ b/metadata/de.spiritcroc.defaultdarktheme_oms/en-US/summary.txt @@ -0,0 +1 @@ +A dark Substratum theme targeting Android 7 & 8 diff --git a/metadata/de.uwepost.android.deltacam.yml b/metadata/de.uwepost.android.deltacam.yml index d598be616e..bd2740dddc 100644 --- a/metadata/de.uwepost.android.deltacam.yml +++ b/metadata/de.uwepost.android.deltacam.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/upost/DeltaCamera IssueTracker: https://github.com/upost/DeltaCamera/issues AutoName: DeltaCamera -Summary: Record movement (deltas) in one single image Description: DeltaCamera uses the camera to record movement (thus *Delta*) and visualize it in one picture. For example running ants leave dark lines on a light surface, or driving cars make light lines on a dark surface. Make sure not to move the diff --git a/metadata/de.uwepost.android.deltacam/en-US/summary.txt b/metadata/de.uwepost.android.deltacam/en-US/summary.txt new file mode 100644 index 0000000000..5a09ffe5db --- /dev/null +++ b/metadata/de.uwepost.android.deltacam/en-US/summary.txt @@ -0,0 +1 @@ +Record movement (deltas) in one single image diff --git a/metadata/deep.ryd.rydplayer.yml b/metadata/deep.ryd.rydplayer.yml index a7b3d71a6a..571b553ebf 100644 --- a/metadata/deep.ryd.rydplayer.yml +++ b/metadata/deep.ryd.rydplayer.yml @@ -9,7 +9,6 @@ IssueTracker: https://github.com/deep-gaurav/MusicPiped/issues Changelog: https://github.com/deep-gaurav/MusicPiped/releases AutoName: MusicPiped -Summary: Materialistic music player that streams music from YouTube Description: |- MusicPiped is a full-featured music player that streams from YouTube instead of playing local files. diff --git a/metadata/deep.ryd.rydplayer/en-US/summary.txt b/metadata/deep.ryd.rydplayer/en-US/summary.txt new file mode 100644 index 0000000000..d895caf0e0 --- /dev/null +++ b/metadata/deep.ryd.rydplayer/en-US/summary.txt @@ -0,0 +1 @@ +Materialistic music player that streams music from YouTube diff --git a/metadata/dk.kjeldsen.carwingsflutter.yml b/metadata/dk.kjeldsen.carwingsflutter.yml index aefe8cf2ca..4a53831cb3 100644 --- a/metadata/dk.kjeldsen.carwingsflutter.yml +++ b/metadata/dk.kjeldsen.carwingsflutter.yml @@ -8,7 +8,6 @@ SourceCode: https://gitlab.com/tobiaswkjeldsen/carwingsflutter IssueTracker: https://gitlab.com/tobiaswkjeldsen/carwingsflutter/issues AutoName: My Leaf -Summary: Remote control and information for your Nissan Leaf Description: |- My Leaf is a simple and fast alternative to the official NissanConnect EV app from Nissan. diff --git a/metadata/dk.kjeldsen.carwingsflutter/en-US/summary.txt b/metadata/dk.kjeldsen.carwingsflutter/en-US/summary.txt new file mode 100644 index 0000000000..5ca6b71a97 --- /dev/null +++ b/metadata/dk.kjeldsen.carwingsflutter/en-US/summary.txt @@ -0,0 +1 @@ +Remote control and information for your Nissan Leaf diff --git a/metadata/dnsfilter.android.yml b/metadata/dnsfilter.android.yml index 908a76cbfc..1620416d53 100644 --- a/metadata/dnsfilter.android.yml +++ b/metadata/dnsfilter.android.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/IngoZenz/personaldnsfilter/issues Changelog: https://github.com/IngoZenz/personaldnsfilter/releases AutoName: DNSfilter -Summary: DNS request based Host Blocker over local VPN using a Blocklist Description: |- ''personalDNSfilter'' is a DNS filter proxy written in Java. It hooks into the domain name (DNS) resolution and returns the loopback address for diff --git a/metadata/dnsfilter.android/en-US/summary.txt b/metadata/dnsfilter.android/en-US/summary.txt new file mode 100644 index 0000000000..393253636e --- /dev/null +++ b/metadata/dnsfilter.android/en-US/summary.txt @@ -0,0 +1 @@ +DNS request based Host Blocker over local VPN using a Blocklist diff --git a/metadata/eu.depau.etchdroid.yml b/metadata/eu.depau.etchdroid.yml index 5e701d331e..6c7ad317fb 100644 --- a/metadata/eu.depau.etchdroid.yml +++ b/metadata/eu.depau.etchdroid.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/EtchDroid/EtchDroid/issues Donate: https://etchdroid.depau.eu/donate/ AutoName: EtchDroid -Summary: An application that helps you write images to USB drives, no root required Description: |- EtchDroid is an open-source application that helps you write images to USB drives. You can use it to make a bootable GNU/Linux USB drive when your laptop is dead diff --git a/metadata/eu.depau.etchdroid/en-US/summary.txt b/metadata/eu.depau.etchdroid/en-US/summary.txt new file mode 100644 index 0000000000..cbdd696ff9 --- /dev/null +++ b/metadata/eu.depau.etchdroid/en-US/summary.txt @@ -0,0 +1 @@ +An application that helps you write images to USB drives, no root required diff --git a/metadata/eu.droogers.smsmatrix.yml b/metadata/eu.droogers.smsmatrix.yml index 58df519b0b..586d453991 100644 --- a/metadata/eu.droogers.smsmatrix.yml +++ b/metadata/eu.droogers.smsmatrix.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/tijder/SmsMatrix/issues Changelog: https://github.com/tijder/SmsMatrix/releases AutoName: SmsMatrix -Summary: Matrix SMS bridge Description: |- This app bridges all sms messages to matrix. For every (new) text conversation contact the bot will open a private 1:1 room and sends the diff --git a/metadata/eu.droogers.smsmatrix/en-US/summary.txt b/metadata/eu.droogers.smsmatrix/en-US/summary.txt new file mode 100644 index 0000000000..18aa508c4c --- /dev/null +++ b/metadata/eu.droogers.smsmatrix/en-US/summary.txt @@ -0,0 +1 @@ +Matrix SMS bridge diff --git a/metadata/eu.faircode.email.yml b/metadata/eu.faircode.email.yml index 0ebec539a8..c8af53650e 100644 --- a/metadata/eu.faircode.email.yml +++ b/metadata/eu.faircode.email.yml @@ -10,7 +10,6 @@ Donate: https://email.faircode.eu/pro/ Bitcoin: 13nUbfsLUzK9Sr7ZJgDRHNR91BJMuDuJnf AutoName: FairEmail -Summary: Privacy friendly email app Description: |- This email app might be for you if your current email app: * takes long to receive or to show messages diff --git a/metadata/eu.faircode.email/en-US/summary.txt b/metadata/eu.faircode.email/en-US/summary.txt new file mode 100644 index 0000000000..971f655cd1 --- /dev/null +++ b/metadata/eu.faircode.email/en-US/summary.txt @@ -0,0 +1 @@ +Privacy friendly email app diff --git a/metadata/eu.faircode.netguard.yml b/metadata/eu.faircode.netguard.yml index 9e6505bdfd..68aef16561 100644 --- a/metadata/eu.faircode.netguard.yml +++ b/metadata/eu.faircode.netguard.yml @@ -10,7 +10,6 @@ Donate: https://www.netguard.me Bitcoin: 13vtPytVVqCwojmohAqsK61Tk4yGXSWpJK AutoName: NetGuard -Summary: Block network access Description: |- NetGuard provides simple and advanced ways to block access to the internet - no root required. diff --git a/metadata/eu.faircode.netguard/en-US/summary.txt b/metadata/eu.faircode.netguard/en-US/summary.txt new file mode 100644 index 0000000000..82944b4bcf --- /dev/null +++ b/metadata/eu.faircode.netguard/en-US/summary.txt @@ -0,0 +1 @@ +Block network access diff --git a/metadata/eu.faircode.xlua.yml b/metadata/eu.faircode.xlua.yml index 87e306dd95..8c63866fc7 100644 --- a/metadata/eu.faircode.xlua.yml +++ b/metadata/eu.faircode.xlua.yml @@ -11,7 +11,6 @@ Donate: https://lua.xprivacy.eu/ Bitcoin: 1GePXhRPgLhwQmBwRHhX1nSCgvfnCY97Gg AutoName: XPrivacyLua -Summary: Really simple to use privacy manager for Marshmallow (6.0) and later Description: |- '''XPosed Module''', get [[de.robv.android.xposed.installer]]. diff --git a/metadata/eu.faircode.xlua/en-US/summary.txt b/metadata/eu.faircode.xlua/en-US/summary.txt new file mode 100644 index 0000000000..0a7c0b98ad --- /dev/null +++ b/metadata/eu.faircode.xlua/en-US/summary.txt @@ -0,0 +1 @@ +Really simple to use privacy manager for Marshmallow (6.0) and later diff --git a/metadata/eu.halaser.beamctrl.yml b/metadata/eu.halaser.beamctrl.yml index dcd9e15eda..340730bafb 100644 --- a/metadata/eu.halaser.beamctrl.yml +++ b/metadata/eu.halaser.beamctrl.yml @@ -5,7 +5,6 @@ WebSite: https://openapc.com/support.php SourceCode: https://sourceforge.net/p/oapc/code/ci/master/tree/BeamControl AutoName: BeamControl for Smart Interface -Summary: Control / notification application for smart factory/industry 4.0 applications Description: |- This application makes use of the Smart Factory (Industry 4.0) interface of BeamConstruct laser marking software, RepliSLS3D SLS/SLM/3D printing diff --git a/metadata/eu.halaser.beamctrl/en-US/summary.txt b/metadata/eu.halaser.beamctrl/en-US/summary.txt new file mode 100644 index 0000000000..fd2ca5b0e3 --- /dev/null +++ b/metadata/eu.halaser.beamctrl/en-US/summary.txt @@ -0,0 +1 @@ +Control / notification application for smart factory/industry 4.0 applications diff --git a/metadata/eu.pretix.pretixdroid.yml b/metadata/eu.pretix.pretixdroid.yml index 383ca80904..228c72d80f 100644 --- a/metadata/eu.pretix.pretixdroid.yml +++ b/metadata/eu.pretix.pretixdroid.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/pretix/pretixdroid IssueTracker: https://github.com/pretix/pretixdroid/issues AutoName: pretixdroid -Summary: Validates tickets generated by pretix Description: |- pretix is an Open Source online ticket shop available at [https://pretix.eu/about/en/] If you organize your conference with pretix, you can use this application to scan the tickets at the entrance. diff --git a/metadata/eu.pretix.pretixdroid/en-US/summary.txt b/metadata/eu.pretix.pretixdroid/en-US/summary.txt new file mode 100644 index 0000000000..089a0a277d --- /dev/null +++ b/metadata/eu.pretix.pretixdroid/en-US/summary.txt @@ -0,0 +1 @@ +Validates tickets generated by pretix diff --git a/metadata/eu.siacs.conversations.legacy.yml b/metadata/eu.siacs.conversations.legacy.yml index cc9d6b3500..39bb4568cd 100644 --- a/metadata/eu.siacs.conversations.legacy.yml +++ b/metadata/eu.siacs.conversations.legacy.yml @@ -10,7 +10,6 @@ LiberapayID: '34225' Bitcoin: 1AeqNAcg85APAZj9BZfAjdFCC5zesqXp2B AutoName: Conversations Legacy -Summary: Chat using the XMPP network Description: |- This special release of Conversations remains on the 1.23.x branch and will provide the same user experience as it was prior to version 2.0.0 diff --git a/metadata/eu.siacs.conversations.legacy/en-US/summary.txt b/metadata/eu.siacs.conversations.legacy/en-US/summary.txt new file mode 100644 index 0000000000..fc25c1faac --- /dev/null +++ b/metadata/eu.siacs.conversations.legacy/en-US/summary.txt @@ -0,0 +1 @@ +Chat using the XMPP network diff --git a/metadata/eu.siacs.conversations.voicerecorder.yml b/metadata/eu.siacs.conversations.voicerecorder.yml index 9aad4c068f..cecdb85691 100644 --- a/metadata/eu.siacs.conversations.voicerecorder.yml +++ b/metadata/eu.siacs.conversations.voicerecorder.yml @@ -8,7 +8,6 @@ Donate: https://www.paypal.com/cgi-bin/webscr?cmd=_s-xclick&hosted_button_id=CW3 Bitcoin: 1AeqNAcg85APAZj9BZfAjdFCC5zesqXp2B AutoName: Voice Recorder Plugin -Summary: Send audio messages via Conversations Description: |- Note: As of Conversations 2.2.0 this functionality is integrated in the main app diff --git a/metadata/eu.siacs.conversations.voicerecorder/en-US/summary.txt b/metadata/eu.siacs.conversations.voicerecorder/en-US/summary.txt new file mode 100644 index 0000000000..e4c020b5ad --- /dev/null +++ b/metadata/eu.siacs.conversations.voicerecorder/en-US/summary.txt @@ -0,0 +1 @@ +Send audio messages via Conversations diff --git a/metadata/eu.siacs.conversations.yml b/metadata/eu.siacs.conversations.yml index c7c205b898..3c7c721a83 100644 --- a/metadata/eu.siacs.conversations.yml +++ b/metadata/eu.siacs.conversations.yml @@ -11,7 +11,6 @@ LiberapayID: '34225' Bitcoin: 1AeqNAcg85APAZj9BZfAjdFCC5zesqXp2B AutoName: Conversations -Summary: A Jabber/XMPP chat client Description: |- Easy to use, reliable, battery friendly. With built-in support for images, group chats and e2e encryption. diff --git a/metadata/eu.siacs.conversations/en-US/summary.txt b/metadata/eu.siacs.conversations/en-US/summary.txt new file mode 100644 index 0000000000..f449ef9c24 --- /dev/null +++ b/metadata/eu.siacs.conversations/en-US/summary.txt @@ -0,0 +1 @@ +A Jabber/XMPP chat client diff --git a/metadata/eu.veldsoft.brainstonz.yml b/metadata/eu.veldsoft.brainstonz.yml index bb9c6f2f00..a47ab63b6c 100644 --- a/metadata/eu.veldsoft.brainstonz.yml +++ b/metadata/eu.veldsoft.brainstonz.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/VelbazhdSoftwareLLC/BrainstonzForAndroid IssueTracker: https://github.com/VelbazhdSoftwareLLC/BrainstonzForAndroid/issues AutoName: Brainstonz for Android -Summary: Brainstonz is a board game for two players Description: | === Object of the Game === diff --git a/metadata/eu.veldsoft.brainstonz/en-US/summary.txt b/metadata/eu.veldsoft.brainstonz/en-US/summary.txt new file mode 100644 index 0000000000..7e64ade903 --- /dev/null +++ b/metadata/eu.veldsoft.brainstonz/en-US/summary.txt @@ -0,0 +1 @@ +Brainstonz is a board game for two players diff --git a/metadata/eu.veldsoft.dice.overflow.yml b/metadata/eu.veldsoft.dice.overflow.yml index 03c95acf9f..821ed4fab1 100644 --- a/metadata/eu.veldsoft.dice.overflow.yml +++ b/metadata/eu.veldsoft.dice.overflow.yml @@ -7,7 +7,6 @@ WebSite: http://github.com/VelbazhdSoftwareLLC/DiceOverflow IssueTracker: https://github.com/VelbazhdSoftwareLLC/DiceOverflow/issues AutoName: Dice Overflow -Summary: Simple board game Description: | Dice Overflow is a simple board logical game developed as master thesis in New Bulgarian University. diff --git a/metadata/eu.veldsoft.dice.overflow/en-US/summary.txt b/metadata/eu.veldsoft.dice.overflow/en-US/summary.txt new file mode 100644 index 0000000000..8620ad15ff --- /dev/null +++ b/metadata/eu.veldsoft.dice.overflow/en-US/summary.txt @@ -0,0 +1 @@ +Simple board game diff --git a/metadata/eu.veldsoft.free.klondike.yml b/metadata/eu.veldsoft.free.klondike.yml index 678c2106b7..76137cc445 100644 --- a/metadata/eu.veldsoft.free.klondike.yml +++ b/metadata/eu.veldsoft.free.klondike.yml @@ -7,7 +7,6 @@ WebSite: https://sourceforge.net/projects/fourrow/ IssueTracker: https://github.com/VelbazhdSoftwareLLC/FreeKlondike/issues AutoName: Free Klondike -Summary: A mixture of FreeCell and Klondike Solitaire Description: | Similarities to FreeCell: diff --git a/metadata/eu.veldsoft.free.klondike/en-US/summary.txt b/metadata/eu.veldsoft.free.klondike/en-US/summary.txt new file mode 100644 index 0000000000..bb4b232660 --- /dev/null +++ b/metadata/eu.veldsoft.free.klondike/en-US/summary.txt @@ -0,0 +1 @@ +A mixture of FreeCell and Klondike Solitaire diff --git a/metadata/eu.veldsoft.house.of.cards.yml b/metadata/eu.veldsoft.house.of.cards.yml index b12847272b..9630896c82 100644 --- a/metadata/eu.veldsoft.house.of.cards.yml +++ b/metadata/eu.veldsoft.house.of.cards.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/VelbazhdSoftwareLLC/HouseOfCards IssueTracker: https://github.com/VelbazhdSoftwareLLC/HouseOfCards/issues AutoName: House of Cards -Summary: Solitaire-like card game Description: |- The game starts with a standard deck of 52 cards. There are also four Houses each “coloured” by one of the four suits. You put one by one diff --git a/metadata/eu.veldsoft.house.of.cards/en-US/summary.txt b/metadata/eu.veldsoft.house.of.cards/en-US/summary.txt new file mode 100644 index 0000000000..6d64fd54e3 --- /dev/null +++ b/metadata/eu.veldsoft.house.of.cards/en-US/summary.txt @@ -0,0 +1 @@ +Solitaire-like card game diff --git a/metadata/eu.veldsoft.kechi.yml b/metadata/eu.veldsoft.kechi.yml index 1c602e9fc4..d5661719c7 100644 --- a/metadata/eu.veldsoft.kechi.yml +++ b/metadata/eu.veldsoft.kechi.yml @@ -7,7 +7,6 @@ WebSite: http://superdupergames.org/gameinfo.html?game=kechi IssueTracker: https://github.com/VelbazhdSoftwareLLC/Kechi/issues AutoName: Kechi -Summary: Board game for two players Description: | Have you ever watched one of those adventure movies where people are fighting on a rickety rope bridge? As they move, diff --git a/metadata/eu.veldsoft.kechi/en-US/summary.txt b/metadata/eu.veldsoft.kechi/en-US/summary.txt new file mode 100644 index 0000000000..fbf2dfb305 --- /dev/null +++ b/metadata/eu.veldsoft.kechi/en-US/summary.txt @@ -0,0 +1 @@ +Board game for two players diff --git a/metadata/eu.veldsoft.tri.peaks.yml b/metadata/eu.veldsoft.tri.peaks.yml index 06a284f8a8..3cd8e890c1 100644 --- a/metadata/eu.veldsoft.tri.peaks.yml +++ b/metadata/eu.veldsoft.tri.peaks.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/VelbazhdSoftwareLLC/TriPeaksSolitaireForAndroid IssueTracker: https://github.com/VelbazhdSoftwareLLC/TriPeaksSolitaireForAndroid/issues AutoName: Tri Peaks Solitaire for Android -Summary: Solitaire card game Description: | TriPeaks Solitaire for Android is a card game in which you remove cards that are adjacent (by value) to the current card. Implementation diff --git a/metadata/eu.veldsoft.tri.peaks/en-US/summary.txt b/metadata/eu.veldsoft.tri.peaks/en-US/summary.txt new file mode 100644 index 0000000000..3bed9c5074 --- /dev/null +++ b/metadata/eu.veldsoft.tri.peaks/en-US/summary.txt @@ -0,0 +1 @@ +Solitaire card game diff --git a/metadata/eu.veldsoft.vitosha.poker.odds.yml b/metadata/eu.veldsoft.vitosha.poker.odds.yml index 36e12e514d..afcb6bc9e0 100644 --- a/metadata/eu.veldsoft.vitosha.poker.odds.yml +++ b/metadata/eu.veldsoft.vitosha.poker.odds.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/VelbazhdSoftwareLLC/android-vitosha-poker-odds IssueTracker: https://github.com/VelbazhdSoftwareLLC/android-vitosha-poker-odds/issues AutoName: VitoshaPokerOdds -Summary: Monte Carlo based Texas Holdem calculator Description: | Vitosha Poker Odds is a Monte Carlo based Texas Holdem calculator. diff --git a/metadata/eu.veldsoft.vitosha.poker.odds/en-US/summary.txt b/metadata/eu.veldsoft.vitosha.poker.odds/en-US/summary.txt new file mode 100644 index 0000000000..8a3e1d4e61 --- /dev/null +++ b/metadata/eu.veldsoft.vitosha.poker.odds/en-US/summary.txt @@ -0,0 +1 @@ +Monte Carlo based Texas Holdem calculator diff --git a/metadata/exa.lnx.a.yml b/metadata/exa.lnx.a.yml index f53775c6bc..5b37c7f070 100644 --- a/metadata/exa.lnx.a.yml +++ b/metadata/exa.lnx.a.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/EXALAB/AnLinux-Adfree IssueTracker: https://github.com/EXALAB/AnLinux-App/issues AutoName: AnLinux -Summary: Run Linux On Android Without Root Access Description: |- This application will allow you to run Linux on Android, by using [[com.termux]] and PRoot technology, you can even run SSH and Xfce4 Desktop diff --git a/metadata/exa.lnx.a/en-US/summary.txt b/metadata/exa.lnx.a/en-US/summary.txt new file mode 100644 index 0000000000..89416eca94 --- /dev/null +++ b/metadata/exa.lnx.a/en-US/summary.txt @@ -0,0 +1 @@ +Run Linux On Android Without Root Access diff --git a/metadata/fi.kroon.vadret.yml b/metadata/fi.kroon.vadret.yml index 3a77208bb9..3826f2e7d6 100644 --- a/metadata/fi.kroon.vadret.yml +++ b/metadata/fi.kroon.vadret.yml @@ -9,7 +9,6 @@ IssueTracker: https://github.com/vadret/android/issues Changelog: https://github.com/vadret/android/blob/HEAD/app/src/main/res/raw/changelog.md AutoName: Vädret -Summary: Weather app for Sweden Description: |- Vädret means weather in Swedish and it is an open source weather app with open data from SMHI Open Data Meteorological Analysis licensed under CC-BY. diff --git a/metadata/fi.kroon.vadret/en-US/summary.txt b/metadata/fi.kroon.vadret/en-US/summary.txt new file mode 100644 index 0000000000..42de2737c3 --- /dev/null +++ b/metadata/fi.kroon.vadret/en-US/summary.txt @@ -0,0 +1 @@ +Weather app for Sweden diff --git a/metadata/fr.bepo.clavierexterne.yml b/metadata/fr.bepo.clavierexterne.yml index 53c2516782..8a9d2f513d 100755 --- a/metadata/fr.bepo.clavierexterne.yml +++ b/metadata/fr.bepo.clavierexterne.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/anisse/bepo-android IssueTracker: https://github.com/anisse/bepo-android/issues AutoName: Bépo clavier externe -Summary: bépo pour clavier externe Description: | Bépo clavier externe est une application qui ajoute le support du bépo pour les claviers externes USB ou bluetooth. diff --git a/metadata/fr.bepo.clavierexterne/en-US/summary.txt b/metadata/fr.bepo.clavierexterne/en-US/summary.txt new file mode 100644 index 0000000000..d19bec809b --- /dev/null +++ b/metadata/fr.bepo.clavierexterne/en-US/summary.txt @@ -0,0 +1 @@ +bépo pour clavier externe diff --git a/metadata/fr.rhaz.ipfs.sweet.yml b/metadata/fr.rhaz.ipfs.sweet.yml index b64446d737..fbbda3fc2d 100644 --- a/metadata/fr.rhaz.ipfs.sweet.yml +++ b/metadata/fr.rhaz.ipfs.sweet.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/RHazDev/Sweet-IPFS IssueTracker: https://github.com/RHazDev/Sweet-IPFS/issues Changelog: https://github.com/RHazDev/Sweet-IPFS/releases -Summary: Run and manage an IPFS node from your device Description: |- ''Sweet IPFS'' is forked from [[org.ligi.ipfsdroid]], which was experimental. This app is currently in beta stage, not all features are diff --git a/metadata/fr.rhaz.ipfs.sweet/en-US/summary.txt b/metadata/fr.rhaz.ipfs.sweet/en-US/summary.txt new file mode 100644 index 0000000000..63fb12ae6e --- /dev/null +++ b/metadata/fr.rhaz.ipfs.sweet/en-US/summary.txt @@ -0,0 +1 @@ +Run and manage an IPFS node from your device diff --git a/metadata/fr.ubordeaux.math.paridroid.yml b/metadata/fr.ubordeaux.math.paridroid.yml index 0fa0af48c9..a1187c213f 100644 --- a/metadata/fr.ubordeaux.math.paridroid.yml +++ b/metadata/fr.ubordeaux.math.paridroid.yml @@ -6,7 +6,6 @@ SourceCode: http://pari.math.u-bordeaux.fr/cgi-bin/gitweb.cgi?p=paridroid.git;a= IssueTracker: http://pari.math.u-bordeaux.fr/Bugs AutoName: PariDroid -Summary: PARI/GP computer algebra system Description: |- PariDroid is a port of PARI/GP to Android. diff --git a/metadata/fr.ubordeaux.math.paridroid/en-US/summary.txt b/metadata/fr.ubordeaux.math.paridroid/en-US/summary.txt new file mode 100644 index 0000000000..56d1a46494 --- /dev/null +++ b/metadata/fr.ubordeaux.math.paridroid/en-US/summary.txt @@ -0,0 +1 @@ +PARI/GP computer algebra system diff --git a/metadata/fr.witchdoctors.c4ffein.oosfirmwareextractor.yml b/metadata/fr.witchdoctors.c4ffein.oosfirmwareextractor.yml index b082f80f70..f3b79951ec 100644 --- a/metadata/fr.witchdoctors.c4ffein.oosfirmwareextractor.yml +++ b/metadata/fr.witchdoctors.c4ffein.oosfirmwareextractor.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/c4ffein/OOS-firmware-updater IssueTracker: https://github.com/c4ffein/OOS-firmware-updater/issues AutoName: OOS Firmware Extractor -Summary: Extract firmware from official Oneplus roms Description: | Extract firmware from an OxygenOS ROM to a custom flashable firmwareupdater.zip You can select a ROM file, unzip it, check extracted files and modified updater-script, then create a flashable firmware update at sdcard/firmwareupdater.zip diff --git a/metadata/fr.witchdoctors.c4ffein.oosfirmwareextractor/en-US/summary.txt b/metadata/fr.witchdoctors.c4ffein.oosfirmwareextractor/en-US/summary.txt new file mode 100644 index 0000000000..73b956e332 --- /dev/null +++ b/metadata/fr.witchdoctors.c4ffein.oosfirmwareextractor/en-US/summary.txt @@ -0,0 +1 @@ +Extract firmware from official Oneplus roms diff --git a/metadata/friimaind.piholedroid.yml b/metadata/friimaind.piholedroid.yml index 42b4c673d2..62af537061 100644 --- a/metadata/friimaind.piholedroid.yml +++ b/metadata/friimaind.piholedroid.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/friimaind/pi-hole-droid IssueTracker: https://github.com/friimaind/pi-hole-droid/issues AutoName: Pi-hole Droid -Summary: Unofficial client that connects to your Pi-hole to show charts and statistics Description: Pi-hole Droid makes use of Pi-hole API to obtain all the data. The credentials is locally stored on your device through localStorage. diff --git a/metadata/friimaind.piholedroid/en-US/summary.txt b/metadata/friimaind.piholedroid/en-US/summary.txt new file mode 100644 index 0000000000..011ef759b7 --- /dev/null +++ b/metadata/friimaind.piholedroid/en-US/summary.txt @@ -0,0 +1 @@ +Unofficial client that connects to your Pi-hole to show charts and statistics diff --git a/metadata/github.vatsal.easyweatherdemo.yml b/metadata/github.vatsal.easyweatherdemo.yml index aa9fb75e9f..a68061737b 100644 --- a/metadata/github.vatsal.easyweatherdemo.yml +++ b/metadata/github.vatsal.easyweatherdemo.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/code-crusher/EasyWeather IssueTracker: https://github.com/code-crusher/EasyWeather/issues AutoName: Easy Weather -Summary: Easy and quick weather app Description: Easy and quick weather fetching from OpenWeatherMap API for Android. RepoType: git diff --git a/metadata/github.vatsal.easyweatherdemo/en-US/summary.txt b/metadata/github.vatsal.easyweatherdemo/en-US/summary.txt new file mode 100644 index 0000000000..b3e2a3cf85 --- /dev/null +++ b/metadata/github.vatsal.easyweatherdemo/en-US/summary.txt @@ -0,0 +1 @@ +Easy and quick weather app diff --git a/metadata/godau.fynn.dsbdirect.yml b/metadata/godau.fynn.dsbdirect.yml index a20ddce0db..16474d7007 100644 --- a/metadata/godau.fynn.dsbdirect.yml +++ b/metadata/godau.fynn.dsbdirect.yml @@ -8,7 +8,6 @@ AuthorEmail: fynngodau@mailbox.org SourceCode: https://notabug.org/fynngodau/DSBDirect AutoName: DSBDirect -Summary: Access AvH Schweinfurt's DSB board Description: |- '''If you are not either student or teacher at Alexander-von-Humboldt- Gymnasium Schweinfurt, you will not find this application useful.''' You diff --git a/metadata/godau.fynn.dsbdirect/en-US/summary.txt b/metadata/godau.fynn.dsbdirect/en-US/summary.txt new file mode 100644 index 0000000000..7eda069f3b --- /dev/null +++ b/metadata/godau.fynn.dsbdirect/en-US/summary.txt @@ -0,0 +1 @@ +Access AvH Schweinfurt's DSB board diff --git a/metadata/im.quicksy.client.yml b/metadata/im.quicksy.client.yml index 7bc94ea2a9..feb286e319 100644 --- a/metadata/im.quicksy.client.yml +++ b/metadata/im.quicksy.client.yml @@ -13,7 +13,6 @@ LiberapayID: '34225' Bitcoin: 1AeqNAcg85APAZj9BZfAjdFCC5zesqXp2B AutoName: Quicksy -Summary: Jabber/XMPP with Easy Entry and Easy Discovery Description: |- Quicksy is a spin off of the popular Jabber/XMPP client [[eu.siacs.conversations]] with automatic contact discovery. diff --git a/metadata/im.quicksy.client/en-US/summary.txt b/metadata/im.quicksy.client/en-US/summary.txt new file mode 100644 index 0000000000..d57be03b7a --- /dev/null +++ b/metadata/im.quicksy.client/en-US/summary.txt @@ -0,0 +1 @@ +Jabber/XMPP with Easy Entry and Easy Discovery diff --git a/metadata/im.vector.alpha.yml b/metadata/im.vector.alpha.yml index de9bd434d8..f1ad8a9e0b 100644 --- a/metadata/im.vector.alpha.yml +++ b/metadata/im.vector.alpha.yml @@ -12,7 +12,6 @@ LiberapayID: '10794' Bitcoin: 1LxowEgsquZ3UPZ68wHf8v2MDZw82dVmAE AutoName: Riot.im -Summary: Open team collaboration Description: |- Riot gathers all your conversations and app integrations into one single app. diff --git a/metadata/im.vector.alpha/en-US/summary.txt b/metadata/im.vector.alpha/en-US/summary.txt new file mode 100644 index 0000000000..2a9b3af91e --- /dev/null +++ b/metadata/im.vector.alpha/en-US/summary.txt @@ -0,0 +1 @@ +Open team collaboration diff --git a/metadata/info.aario.mywifipasswords.yml b/metadata/info.aario.mywifipasswords.yml index e1f4d6cb91..4611a56d58 100644 --- a/metadata/info.aario.mywifipasswords.yml +++ b/metadata/info.aario.mywifipasswords.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/aario/MyWifiPasswords/issues Donate: https://www.paypal.com/cgi-bin/webscr?cmd=_s-xclick&hosted_button_id=UJTM2GDGPEFHA AutoName: My Wifi Passwords -Summary: View your Wi-Fi Passwords Description: |- Have the Wi-Fi connected on your Android phone and want to share its password with your friend or enter it in your laptop? Don't know where to diff --git a/metadata/info.aario.mywifipasswords/en-US/summary.txt b/metadata/info.aario.mywifipasswords/en-US/summary.txt new file mode 100644 index 0000000000..59f498bd13 --- /dev/null +++ b/metadata/info.aario.mywifipasswords/en-US/summary.txt @@ -0,0 +1 @@ +View your Wi-Fi Passwords diff --git a/metadata/info.guardianproject.courier.yml b/metadata/info.guardianproject.courier.yml index 17d4eb1507..a9667f088d 100644 --- a/metadata/info.guardianproject.courier.yml +++ b/metadata/info.guardianproject.courier.yml @@ -11,7 +11,6 @@ LiberapayID: '33617' Bitcoin: 1Fi5xUHiAPRKxHvyUGVFGt9extBe8Srdbk AutoName: Courier -Summary: Privacy-aware RSS feed reader Description: A feed aggregator/reader focusing on privacy. It supports RSS and ATOM feeds. diff --git a/metadata/info.guardianproject.courier/en-US/summary.txt b/metadata/info.guardianproject.courier/en-US/summary.txt new file mode 100644 index 0000000000..475719a411 --- /dev/null +++ b/metadata/info.guardianproject.courier/en-US/summary.txt @@ -0,0 +1 @@ +Privacy-aware RSS feed reader diff --git a/metadata/info.guardianproject.gilga.yml b/metadata/info.guardianproject.gilga.yml index d468eb6376..e802242d62 100644 --- a/metadata/info.guardianproject.gilga.yml +++ b/metadata/info.guardianproject.gilga.yml @@ -8,7 +8,6 @@ LiberapayID: '33617' Bitcoin: 1Fi5xUHiAPRKxHvyUGVFGt9extBe8Srdbk AutoName: Gilga -Summary: Local chat via Bluetooth Description: |- Use Bluetooth to chat with others in the same area, even if Internet access is down or restricted. diff --git a/metadata/info.guardianproject.gilga/en-US/summary.txt b/metadata/info.guardianproject.gilga/en-US/summary.txt new file mode 100644 index 0000000000..cdf7a862ef --- /dev/null +++ b/metadata/info.guardianproject.gilga/en-US/summary.txt @@ -0,0 +1 @@ +Local chat via Bluetooth diff --git a/metadata/info.guardianproject.notepadbot.yml b/metadata/info.guardianproject.notepadbot.yml index 8ce95852e2..ed97109b48 100644 --- a/metadata/info.guardianproject.notepadbot.yml +++ b/metadata/info.guardianproject.notepadbot.yml @@ -12,7 +12,6 @@ LiberapayID: '33617' Bitcoin: 1Fi5xUHiAPRKxHvyUGVFGt9extBe8Srdbk AutoName: NoteCipher -Summary: Notepad with lock Description: |- Simple app for taking notes that encrypts everything behind a password. diff --git a/metadata/info.guardianproject.notepadbot/en-US/summary.txt b/metadata/info.guardianproject.notepadbot/en-US/summary.txt new file mode 100644 index 0000000000..17612180c0 --- /dev/null +++ b/metadata/info.guardianproject.notepadbot/en-US/summary.txt @@ -0,0 +1 @@ +Notepad with lock diff --git a/metadata/info.guardianproject.orfox.yml b/metadata/info.guardianproject.orfox.yml index 840aa5d77e..096ab626a2 100644 --- a/metadata/info.guardianproject.orfox.yml +++ b/metadata/info.guardianproject.orfox.yml @@ -13,7 +13,6 @@ LiberapayID: '33617' Bitcoin: 1Fi5xUHiAPRKxHvyUGVFGt9extBe8Srdbk Name: Orfox -Summary: TOR Browser Description: |- This is a new privacy-enhanced browser -- based on Mozilla Firefox, configured by default to work with Orbot: Tor for Android. diff --git a/metadata/info.guardianproject.orfox/en-US/summary.txt b/metadata/info.guardianproject.orfox/en-US/summary.txt new file mode 100644 index 0000000000..b5d6d11558 --- /dev/null +++ b/metadata/info.guardianproject.orfox/en-US/summary.txt @@ -0,0 +1 @@ +TOR Browser diff --git a/metadata/info.guardianproject.pixelknot.yml b/metadata/info.guardianproject.pixelknot.yml index 80f28f8e6c..711443c87e 100644 --- a/metadata/info.guardianproject.pixelknot.yml +++ b/metadata/info.guardianproject.pixelknot.yml @@ -12,7 +12,6 @@ LiberapayID: '33617' Bitcoin: 1Fi5xUHiAPRKxHvyUGVFGt9extBe8Srdbk AutoName: PixelKnot -Summary: Hide messages inside files Description: |- Image steganography app with old school F5 steganography. diff --git a/metadata/info.guardianproject.pixelknot/en-US/summary.txt b/metadata/info.guardianproject.pixelknot/en-US/summary.txt new file mode 100644 index 0000000000..40ec5b5180 --- /dev/null +++ b/metadata/info.guardianproject.pixelknot/en-US/summary.txt @@ -0,0 +1 @@ +Hide messages inside files diff --git a/metadata/info.metadude.android.bitsundbaeume.schedule.yml b/metadata/info.metadude.android.bitsundbaeume.schedule.yml index c2d48cb098..68b7add993 100644 --- a/metadata/info.metadude.android.bitsundbaeume.schedule.yml +++ b/metadata/info.metadude.android.bitsundbaeume.schedule.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/johnjohndoe/CampFahrplan/tree/bitsundbaeume-2018 IssueTracker: https://github.com/EventFahrplan/EventFahrplan/issues AutoName: Bits & Bäume 2018 -Summary: Die Konferenz für Digitalisierung und Nachhaltigkeit Description: |- [http://bits-und-baeume.org bits-und-baeume.org] diff --git a/metadata/info.metadude.android.bitsundbaeume.schedule/en-US/summary.txt b/metadata/info.metadude.android.bitsundbaeume.schedule/en-US/summary.txt new file mode 100644 index 0000000000..ab6087bb7a --- /dev/null +++ b/metadata/info.metadude.android.bitsundbaeume.schedule/en-US/summary.txt @@ -0,0 +1 @@ +Die Konferenz für Digitalisierung und Nachhaltigkeit diff --git a/metadata/info.metadude.android.congress.schedule.yml b/metadata/info.metadude.android.congress.schedule.yml index 723c0df5c8..fc3164acf9 100644 --- a/metadata/info.metadude.android.congress.schedule.yml +++ b/metadata/info.metadude.android.congress.schedule.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/EventFahrplan/EventFahrplan IssueTracker: https://github.com/EventFahrplan/EventFahrplan/issues AutoName: 35C3 Schedule -Summary: Schedule (aka Fahrplan) of the 35C3 Description: Conference app for the 35C3 (35. Chaos Communication Congress) RepoType: git diff --git a/metadata/info.metadude.android.congress.schedule/en-US/summary.txt b/metadata/info.metadude.android.congress.schedule/en-US/summary.txt new file mode 100644 index 0000000000..0d95febfc4 --- /dev/null +++ b/metadata/info.metadude.android.congress.schedule/en-US/summary.txt @@ -0,0 +1 @@ +Schedule (aka Fahrplan) of the 35C3 diff --git a/metadata/info.tangential.cone.yml b/metadata/info.tangential.cone.yml index dad4373ff9..88e10f8ad4 100644 --- a/metadata/info.tangential.cone.yml +++ b/metadata/info.tangential.cone.yml @@ -5,7 +5,6 @@ WebSite: https://github.com/bradyt/cone IssueTracker: https://github.com/bradyt/cone/issues AutoName: cone -Summary: Data entry tool for the plain text accounting ledger format Description: | Whereas ledger-cli is the original ledger app, and hledger, beancount and transity are a few of the number of ledger-likes, cone brings the diff --git a/metadata/info.tangential.cone/en-US/summary.txt b/metadata/info.tangential.cone/en-US/summary.txt new file mode 100644 index 0000000000..cb25e01089 --- /dev/null +++ b/metadata/info.tangential.cone/en-US/summary.txt @@ -0,0 +1 @@ +Data entry tool for the plain text accounting ledger format diff --git a/metadata/info.zamojski.soft.towercollector.yml b/metadata/info.zamojski.soft.towercollector.yml index aaf8994539..cb429e7f14 100644 --- a/metadata/info.zamojski.soft.towercollector.yml +++ b/metadata/info.zamojski.soft.towercollector.yml @@ -8,7 +8,6 @@ IssueTracker: https://github.com/zamojski/TowerCollector/issues Changelog: https://github.com/zamojski/TowerCollector/releases AutoName: Tower Collector -Summary: Join the community and collect cell towers locations from your area Description: |- Tower Collector gives you opportunity to contribute in OpenCellID.org and Mozilla Location Services projects by uploading GPS locations of diff --git a/metadata/info.zamojski.soft.towercollector/en-US/summary.txt b/metadata/info.zamojski.soft.towercollector/en-US/summary.txt new file mode 100644 index 0000000000..fda8a7fc3a --- /dev/null +++ b/metadata/info.zamojski.soft.towercollector/en-US/summary.txt @@ -0,0 +1 @@ +Join the community and collect cell towers locations from your area diff --git a/metadata/io.github.deweyreed.clipboardcleaner.yml b/metadata/io.github.deweyreed.clipboardcleaner.yml index 5ff6d1169d..c19338d43a 100644 --- a/metadata/io.github.deweyreed.clipboardcleaner.yml +++ b/metadata/io.github.deweyreed.clipboardcleaner.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/DeweyReed/ClipboardCleaner/issues Changelog: https://github.com/DeweyReed/ClipboardCleaner/releases AutoName: ClipboardCleaner -Summary: Check and clean your clipboard Description: |- As you may know, Android clipboard content and its changes can be accessed by any app, which is a security hole if you care about it. Any app can get your copied password, credit card numbers diff --git a/metadata/io.github.deweyreed.clipboardcleaner/en-US/summary.txt b/metadata/io.github.deweyreed.clipboardcleaner/en-US/summary.txt new file mode 100644 index 0000000000..7c0b731d56 --- /dev/null +++ b/metadata/io.github.deweyreed.clipboardcleaner/en-US/summary.txt @@ -0,0 +1 @@ +Check and clean your clipboard diff --git a/metadata/io.github.lufte.lona.yml b/metadata/io.github.lufte.lona.yml index 4d107526bc..0bfa20ac75 100644 --- a/metadata/io.github.lufte.lona.yml +++ b/metadata/io.github.lufte.lona.yml @@ -5,7 +5,6 @@ WebSite: https://lufte.github.io/lona SourceCode: https://github.com/lufte/lona IssueTracker: https://github.com/lufte/lona/issues -Summary: A snake-like HTML5 game Description: A snake game with a twist. RepoType: git diff --git a/metadata/io.github.lufte.lona/en-US/summary.txt b/metadata/io.github.lufte.lona/en-US/summary.txt new file mode 100644 index 0000000000..3520a8124c --- /dev/null +++ b/metadata/io.github.lufte.lona/en-US/summary.txt @@ -0,0 +1 @@ +A snake-like HTML5 game diff --git a/metadata/io.github.project_travel_mate.yml b/metadata/io.github.project_travel_mate.yml index dc20ab41ea..92536b192c 100644 --- a/metadata/io.github.project_travel_mate.yml +++ b/metadata/io.github.project_travel_mate.yml @@ -8,7 +8,6 @@ SourceCode: https://github.com/project-travel-mate/Travel-Mate IssueTracker: https://github.com/project-travel-mate/Travel-Mate/issues AutoName: Travel Mate -Summary: A complete travel guide Description: |- Travel Mate is a must-have app for those interested in travel. The app provides users with various features from choosing the correct destination for making all the bookings and to easily organizing the trip. diff --git a/metadata/io.github.project_travel_mate/en-US/summary.txt b/metadata/io.github.project_travel_mate/en-US/summary.txt new file mode 100644 index 0000000000..6f863920b1 --- /dev/null +++ b/metadata/io.github.project_travel_mate/en-US/summary.txt @@ -0,0 +1 @@ +A complete travel guide diff --git a/metadata/io.github.subhamtyagi.openinwhatsapp.yml b/metadata/io.github.subhamtyagi.openinwhatsapp.yml index be5481ccad..a5d4e87eb7 100644 --- a/metadata/io.github.subhamtyagi.openinwhatsapp.yml +++ b/metadata/io.github.subhamtyagi.openinwhatsapp.yml @@ -9,7 +9,6 @@ SourceCode: https://github.com/subhamtyagi/openinwa IssueTracker: https://github.com/subhamtyagi/openinwa/issues AutoName: Open In WhatsApp -Summary: Open Chat in WhatsApp Description: |- Open chat in WhatsApp without saving phone number to your phonebook diff --git a/metadata/io.github.subhamtyagi.openinwhatsapp/en-US/summary.txt b/metadata/io.github.subhamtyagi.openinwhatsapp/en-US/summary.txt new file mode 100644 index 0000000000..b463f26154 --- /dev/null +++ b/metadata/io.github.subhamtyagi.openinwhatsapp/en-US/summary.txt @@ -0,0 +1 @@ +Open Chat in WhatsApp diff --git a/metadata/io.github.subhamtyagi.privacyapplock.yml b/metadata/io.github.subhamtyagi.privacyapplock.yml index ce4ceaaf35..8feaf57f3a 100644 --- a/metadata/io.github.subhamtyagi.privacyapplock.yml +++ b/metadata/io.github.subhamtyagi.privacyapplock.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/SubhamTyagi/AppLock IssueTracker: https://github.com/SubhamTyagi/AppLock/issues AutoName: App Lock -Summary: Privacy App lock Description: |- AppLock is a smarter and safer and open source android app locker, which guards your privacy security with pattern lock. diff --git a/metadata/io.github.subhamtyagi.privacyapplock/en-US/summary.txt b/metadata/io.github.subhamtyagi.privacyapplock/en-US/summary.txt new file mode 100644 index 0000000000..e414a4e1cc --- /dev/null +++ b/metadata/io.github.subhamtyagi.privacyapplock/en-US/summary.txt @@ -0,0 +1 @@ +Privacy App lock diff --git a/metadata/io.github.tiagoshibata.gpsdclient.yml b/metadata/io.github.tiagoshibata.gpsdclient.yml index 6c4feceaba..9b30b7756c 100644 --- a/metadata/io.github.tiagoshibata.gpsdclient.yml +++ b/metadata/io.github.tiagoshibata.gpsdclient.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/tiagoshibata/Android-GPSd-Client IssueTracker: https://github.com/tiagoshibata/Android-GPSd-Client/issues AutoName: GPSd Client -Summary: Service to forward NMEA messages to a GPSd server Description: |- This application forwards NMEA data from your phone's GPS to a specified host. It's goal is to easily plug and feed data into a GPS server service (e.g. GPSd), diff --git a/metadata/io.github.tiagoshibata.gpsdclient/en-US/summary.txt b/metadata/io.github.tiagoshibata.gpsdclient/en-US/summary.txt new file mode 100644 index 0000000000..120dbdbc1e --- /dev/null +++ b/metadata/io.github.tiagoshibata.gpsdclient/en-US/summary.txt @@ -0,0 +1 @@ +Service to forward NMEA messages to a GPSd server diff --git a/metadata/io.mainframe.hacs.yml b/metadata/io.mainframe.hacs.yml index c2c9476c46..741aaf75a3 100644 --- a/metadata/io.mainframe.hacs.yml +++ b/metadata/io.mainframe.hacs.yml @@ -8,7 +8,6 @@ IssueTracker: https://github.com/ktt-ol/hacs/issues Changelog: https://github.com/ktt-ol/hacs/blob/HEAD/CHANGELOG.md AutoName: HACS -Summary: Hackspace Access Control System Description: An app for our "keyholder" to view and manage the door states of the hackspace. It uses an mqtt service to get the current status and sends door commands per ssh. diff --git a/metadata/io.mainframe.hacs/en-US/summary.txt b/metadata/io.mainframe.hacs/en-US/summary.txt new file mode 100644 index 0000000000..610deea28f --- /dev/null +++ b/metadata/io.mainframe.hacs/en-US/summary.txt @@ -0,0 +1 @@ +Hackspace Access Control System diff --git a/metadata/it.diab.yml b/metadata/it.diab.yml index 68f6546133..c965051c0b 100644 --- a/metadata/it.diab.yml +++ b/metadata/it.diab.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/bvlj/diab IssueTracker: https://github.com/bvlj/diab/issues AutoName: Diab -Summary: A smart diabetes manager app Description: |- Diab is a smart opensource application that helps you managing your diabetes by keeping track of your glucose values and insulin injections. diff --git a/metadata/it.diab/en-US/summary.txt b/metadata/it.diab/en-US/summary.txt new file mode 100644 index 0000000000..5d04d93b7e --- /dev/null +++ b/metadata/it.diab/en-US/summary.txt @@ -0,0 +1 @@ +A smart diabetes manager app diff --git a/metadata/joshuatee.wx.yml b/metadata/joshuatee.wx.yml index 8e31a5b8ab..e897514041 100644 --- a/metadata/joshuatee.wx.yml +++ b/metadata/joshuatee.wx.yml @@ -8,7 +8,6 @@ IssueTracker: https://gitlab.com/joshua.tee/wx/issues Changelog: https://drive.google.com/drive/folders/0B9OogdTO1kXqcVJwekpwemFwSXM AutoName: wX -Summary: Weather app geared towards storm chasers, meteorologists and weather enthusiasts Description: |- NWS ( National Weather Service ) data is optimized for mobile format and provided for divisions not normally covered together in the mobile space: SPC, WPC, NHC, OPC, etc. Level 3 and Level 2 Nexrad radar ( single, dual, quad pane ) are provided and displayed using the mobile variant of OpenGL. This weather app is not affiliated with NOAA or the National Weather Service. diff --git a/metadata/joshuatee.wx/en-US/summary.txt b/metadata/joshuatee.wx/en-US/summary.txt new file mode 100644 index 0000000000..65b5b5614b --- /dev/null +++ b/metadata/joshuatee.wx/en-US/summary.txt @@ -0,0 +1 @@ +Weather app geared towards storm chasers, meteorologists and weather enthusiasts diff --git a/metadata/jp.ddo.hotmist.unicodepad.yml b/metadata/jp.ddo.hotmist.unicodepad.yml index ec701b4bc6..39a8bf594f 100644 --- a/metadata/jp.ddo.hotmist.unicodepad.yml +++ b/metadata/jp.ddo.hotmist.unicodepad.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/Ryosuke839/UnicodePad/issues Changelog: https://github.com/Ryosuke839/UnicodePad/releases AutoName: UnicodePad -Summary: Input every character in Unicode Description: |- ''UnicodePad'' lets you input every character in Unicode. And input string can be copied to the clipboard or input directly by Mushroom. You can find out diff --git a/metadata/jp.ddo.hotmist.unicodepad/en-US/summary.txt b/metadata/jp.ddo.hotmist.unicodepad/en-US/summary.txt new file mode 100644 index 0000000000..2b6cc019e3 --- /dev/null +++ b/metadata/jp.ddo.hotmist.unicodepad/en-US/summary.txt @@ -0,0 +1 @@ +Input every character in Unicode diff --git a/metadata/jp.takke.cpustats.yml b/metadata/jp.takke.cpustats.yml index 088cab87cd..1279803842 100644 --- a/metadata/jp.takke.cpustats.yml +++ b/metadata/jp.takke.cpustats.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/takke/cpustats/issues Changelog: https://github.com/takke/cpustats/blob/HEAD/ChangeLog.txt AutoName: CPU Stats -Summary: Show CPU usage within the statusbar Description: |- Simple tool that displays usage details of the CPU within the statusbar. diff --git a/metadata/jp.takke.cpustats/en-US/summary.txt b/metadata/jp.takke.cpustats/en-US/summary.txt new file mode 100644 index 0000000000..bb36fdc65c --- /dev/null +++ b/metadata/jp.takke.cpustats/en-US/summary.txt @@ -0,0 +1 @@ +Show CPU usage within the statusbar diff --git a/metadata/makeinfo.com.getid.yml b/metadata/makeinfo.com.getid.yml index 931e2b5cad..82697c8373 100644 --- a/metadata/makeinfo.com.getid.yml +++ b/metadata/makeinfo.com.getid.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/basil2style/getid IssueTracker: https://github.com/basil2style/getid/issues AutoName: Get ID -Summary: Get device id and information Description: |- Get and show device details like: diff --git a/metadata/makeinfo.com.getid/en-US/summary.txt b/metadata/makeinfo.com.getid/en-US/summary.txt new file mode 100644 index 0000000000..e63e84cfbf --- /dev/null +++ b/metadata/makeinfo.com.getid/en-US/summary.txt @@ -0,0 +1 @@ +Get device id and information diff --git a/metadata/mancioboxblog.altervista.it.volumecontrol.yml b/metadata/mancioboxblog.altervista.it.volumecontrol.yml index 3ff1652ad2..a5ec1ade31 100644 --- a/metadata/mancioboxblog.altervista.it.volumecontrol.yml +++ b/metadata/mancioboxblog.altervista.it.volumecontrol.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/mancio/Volume-Control IssueTracker: https://github.com/mancio/Volume-Control/issues AutoName: Volume Control -Summary: Change volume without buttons Description: |- Resizable widget that reveals more functionality depending on size. Channels can be isolated and a mute switch is present. diff --git a/metadata/mancioboxblog.altervista.it.volumecontrol/en-US/summary.txt b/metadata/mancioboxblog.altervista.it.volumecontrol/en-US/summary.txt new file mode 100644 index 0000000000..4942031ae3 --- /dev/null +++ b/metadata/mancioboxblog.altervista.it.volumecontrol/en-US/summary.txt @@ -0,0 +1 @@ +Change volume without buttons diff --git a/metadata/marto.rtl_tcp_andro.yml b/metadata/marto.rtl_tcp_andro.yml index 9f8fbf2b02..90c135d821 100644 --- a/metadata/marto.rtl_tcp_andro.yml +++ b/metadata/marto.rtl_tcp_andro.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/martinmarinov/rtl_tcp_andro- IssueTracker: https://github.com/martinmarinov/rtl_tcp_andro-/issues AutoName: Rtl-sdr driver -Summary: Port of rtl-sdr's rtl_tcp Description: |- Allows you to use I/Q packet source in your Android applications. diff --git a/metadata/marto.rtl_tcp_andro/en-US/summary.txt b/metadata/marto.rtl_tcp_andro/en-US/summary.txt new file mode 100644 index 0000000000..146bd3d2bf --- /dev/null +++ b/metadata/marto.rtl_tcp_andro/en-US/summary.txt @@ -0,0 +1 @@ +Port of rtl-sdr's rtl_tcp diff --git a/metadata/mavonst.app.easylight.yml b/metadata/mavonst.app.easylight.yml index cdbcca0410..34c64e3142 100644 --- a/metadata/mavonst.app.easylight.yml +++ b/metadata/mavonst.app.easylight.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/mavonst/easyLight IssueTracker: https://github.com/mavonst/easyLight/issues AutoName: EasyLight -Summary: Flashlight Description: |- Installs a service to communicate with the LED flash. Usable from an stand-alone app and a widget. diff --git a/metadata/mavonst.app.easylight/en-US/summary.txt b/metadata/mavonst.app.easylight/en-US/summary.txt new file mode 100644 index 0000000000..c395446430 --- /dev/null +++ b/metadata/mavonst.app.easylight/en-US/summary.txt @@ -0,0 +1 @@ +Flashlight diff --git a/metadata/max.music_cyclon.yml b/metadata/max.music_cyclon.yml index 4f0f13daee..0920412406 100644 --- a/metadata/max.music_cyclon.yml +++ b/metadata/max.music_cyclon.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/maxammann/music-cyclon IssueTracker: https://github.com/maxammann/music-cyclon/issues AutoName: music-cyclon -Summary: App to synchronize music over network by using the beets web server Description: |- This App allows you to synchronize music over network by using the [http://beets.io/ beets] web server. You can find instructions for running a diff --git a/metadata/max.music_cyclon/en-US/summary.txt b/metadata/max.music_cyclon/en-US/summary.txt new file mode 100644 index 0000000000..7c63309730 --- /dev/null +++ b/metadata/max.music_cyclon/en-US/summary.txt @@ -0,0 +1 @@ +App to synchronize music over network by using the beets web server diff --git a/metadata/mazechazer.android.wottankquiz.yml b/metadata/mazechazer.android.wottankquiz.yml index dcb018154c..c0c855f98f 100644 --- a/metadata/mazechazer.android.wottankquiz.yml +++ b/metadata/mazechazer.android.wottankquiz.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/MazeChaZer/WoT-Tank-Quiz IssueTracker: https://github.com/MazeChaZer/WoT-Tank-Quiz/issues AutoName: WoT Tank Quiz -Summary: Quiz about the PC game World of Tanks Description: |- The WoT Tank Quiz is about guessing the names of tanks from the PC game World of Tanks from their images. For each picture there are always 4 differnt possible diff --git a/metadata/mazechazer.android.wottankquiz/en-US/summary.txt b/metadata/mazechazer.android.wottankquiz/en-US/summary.txt new file mode 100644 index 0000000000..8b5c9c1873 --- /dev/null +++ b/metadata/mazechazer.android.wottankquiz/en-US/summary.txt @@ -0,0 +1 @@ +Quiz about the PC game World of Tanks diff --git a/metadata/mbmb5.lumixextendedcontrolapp.yml b/metadata/mbmb5.lumixextendedcontrolapp.yml index 2cc91d1ae4..fd81e5d3ed 100644 --- a/metadata/mbmb5.lumixextendedcontrolapp.yml +++ b/metadata/mbmb5.lumixextendedcontrolapp.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/mbmb5/Eylca IssueTracker: https://github.com/mbmb5/Eylca/issues AutoName: Eylca -Summary: Control a lumix camera remotely Description: |- Aims at extending lumix camera abilities. Eylca currently allows to shoot pictures or to record a video when a motion is detected in what the camera sees. diff --git a/metadata/mbmb5.lumixextendedcontrolapp/en-US/summary.txt b/metadata/mbmb5.lumixextendedcontrolapp/en-US/summary.txt new file mode 100644 index 0000000000..4b54167461 --- /dev/null +++ b/metadata/mbmb5.lumixextendedcontrolapp/en-US/summary.txt @@ -0,0 +1 @@ +Control a lumix camera remotely diff --git a/metadata/me.alexghr.bulkshare.android.app2.yml b/metadata/me.alexghr.bulkshare.android.app2.yml index 7d70f9b502..ef8af0b743 100644 --- a/metadata/me.alexghr.bulkshare.android.app2.yml +++ b/metadata/me.alexghr.bulkshare.android.app2.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/alexghr/bulkshare/issues Changelog: https://github.com/alexghr/bulkshare/blob/HEAD/CHANGELOG.md AutoName: Bulkshare 2 -Summary: Share multiple URLs Description: |- Select multiple URLs to send via email, SMS, etc. This app was previously known as [[me.alexghr.android.bulkshare]]. diff --git a/metadata/me.alexghr.bulkshare.android.app2/en-US/summary.txt b/metadata/me.alexghr.bulkshare.android.app2/en-US/summary.txt new file mode 100644 index 0000000000..d6c79839ae --- /dev/null +++ b/metadata/me.alexghr.bulkshare.android.app2/en-US/summary.txt @@ -0,0 +1 @@ +Share multiple URLs diff --git a/metadata/me.anon.grow.yml b/metadata/me.anon.grow.yml index 5f37cbdc1e..54bc2817e3 100644 --- a/metadata/me.anon.grow.yml +++ b/metadata/me.anon.grow.yml @@ -4,7 +4,6 @@ License: Apache-2.0 SourceCode: https://github.com/7LPdWcaW/GrowTracker-Android IssueTracker: https://github.com/7LPdWcaW/GrowTracker-Android/issues -Summary: Help record data about growing plants Description: This app helps record data about growing plants in order to monitor the growing conditions to help make the plants grow better, and identify potential issues during the grow process. It requires no permissions except for external diff --git a/metadata/me.anon.grow/en-US/summary.txt b/metadata/me.anon.grow/en-US/summary.txt new file mode 100644 index 0000000000..0f2b4b6276 --- /dev/null +++ b/metadata/me.anon.grow/en-US/summary.txt @@ -0,0 +1 @@ +Help record data about growing plants diff --git a/metadata/me.anuraag.grader.yml b/metadata/me.anuraag.grader.yml index f5ed75e804..b81ca52df4 100644 --- a/metadata/me.anuraag.grader.yml +++ b/metadata/me.anuraag.grader.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/hackathoner/Gradr IssueTracker: https://github.com/hackathoner/Gradr/issues AutoName: Gradr -Summary: Keep track of your grades Description: |- Allows students to simply and easily track their grades. Create classes and add grades for each of those classes. Each grade is created with a name and the diff --git a/metadata/me.anuraag.grader/en-US/summary.txt b/metadata/me.anuraag.grader/en-US/summary.txt new file mode 100644 index 0000000000..6ee27eb1c2 --- /dev/null +++ b/metadata/me.anuraag.grader/en-US/summary.txt @@ -0,0 +1 @@ +Keep track of your grades diff --git a/metadata/me.anuraag.loveactualized.yml b/metadata/me.anuraag.loveactualized.yml index c4bf00b186..1c48b157e4 100644 --- a/metadata/me.anuraag.loveactualized.yml +++ b/metadata/me.anuraag.loveactualized.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/hackathoner/LoveGame IssueTracker: https://github.com/hackathoner/LoveGame/issues AutoName: Love Game -Summary: Dating quiz Description: |- 36 questions which, when asking another partner, almost guarantees each other to fall in love. Questions created by Dr. Arthur Aaron, see diff --git a/metadata/me.anuraag.loveactualized/en-US/summary.txt b/metadata/me.anuraag.loveactualized/en-US/summary.txt new file mode 100644 index 0000000000..bd98572a53 --- /dev/null +++ b/metadata/me.anuraag.loveactualized/en-US/summary.txt @@ -0,0 +1 @@ +Dating quiz diff --git a/metadata/me.blog.korn123.easydiary.yml b/metadata/me.blog.korn123.easydiary.yml index ba45d7fc2e..3ed1a223c4 100644 --- a/metadata/me.blog.korn123.easydiary.yml +++ b/metadata/me.blog.korn123.easydiary.yml @@ -4,7 +4,6 @@ License: Apache-2.0 SourceCode: https://github.com/hanjoongcho/aaf-easydiary IssueTracker: https://github.com/hanjoongcho/aaf-easydiary/issues -Summary: A diary application optimized for user experience Description: |- Features: diff --git a/metadata/me.blog.korn123.easydiary/en-US/summary.txt b/metadata/me.blog.korn123.easydiary/en-US/summary.txt new file mode 100644 index 0000000000..faa166454a --- /dev/null +++ b/metadata/me.blog.korn123.easydiary/en-US/summary.txt @@ -0,0 +1 @@ +A diary application optimized for user experience diff --git a/metadata/me.bpear.archonpackager.yml b/metadata/me.bpear.archonpackager.yml index d6a59f3f45..c9d4927771 100644 --- a/metadata/me.bpear.archonpackager.yml +++ b/metadata/me.bpear.archonpackager.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/bpear96/ARChon-Packager IssueTracker: https://github.com/bpear96/ARChon-Packager/issues AutoName: ARChon Packager -Summary: Package installed apps for Chrome Description: |- Produce Chrome ARChon Custom Runtime packages directly from your phone. You can generate chrome packages from either APKs on your phones storage or from already diff --git a/metadata/me.bpear.archonpackager/en-US/summary.txt b/metadata/me.bpear.archonpackager/en-US/summary.txt new file mode 100644 index 0000000000..ce1ba11d0b --- /dev/null +++ b/metadata/me.bpear.archonpackager/en-US/summary.txt @@ -0,0 +1 @@ +Package installed apps for Chrome diff --git a/metadata/me.ccrama.redditslide.yml b/metadata/me.ccrama.redditslide.yml index 4ce3d0492a..de174ab44d 100644 --- a/metadata/me.ccrama.redditslide.yml +++ b/metadata/me.ccrama.redditslide.yml @@ -10,7 +10,6 @@ IssueTracker: https://github.com/ccrama/Slide/issues Changelog: https://github.com/ccrama/Slide/blob/HEAD/CHANGELOG.md Name: Slide -Summary: Companion app for reddit Description: |- Slide for Reddit is a feature-packed, material-designed unofficial browser for Reddit with an easy to use UI and tons of customization. Slide is ad-free, open diff --git a/metadata/me.ccrama.redditslide/en-US/summary.txt b/metadata/me.ccrama.redditslide/en-US/summary.txt new file mode 100644 index 0000000000..bc92d3a5e4 --- /dev/null +++ b/metadata/me.ccrama.redditslide/en-US/summary.txt @@ -0,0 +1 @@ +Companion app for reddit diff --git a/metadata/me.echeung.cdflabs.yml b/metadata/me.echeung.cdflabs.yml index 02415450ae..27072a1e1c 100644 --- a/metadata/me.echeung.cdflabs.yml +++ b/metadata/me.echeung.cdflabs.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/arkon/CDFLabs IssueTracker: https://github.com/arkon/CDFLabs/issues AutoName: CS Teaching Labs -Summary: Check availibilty of computers at CDFLabs Description: |- Allows Computer Science students at University of Toronto St George to quickly check how many machines are available in the various CDF computer labs in Bahen diff --git a/metadata/me.echeung.cdflabs/en-US/summary.txt b/metadata/me.echeung.cdflabs/en-US/summary.txt new file mode 100644 index 0000000000..81d4f53443 --- /dev/null +++ b/metadata/me.echeung.cdflabs/en-US/summary.txt @@ -0,0 +1 @@ +Check availibilty of computers at CDFLabs diff --git a/metadata/me.echeung.moemoekyun.fdroid.yml b/metadata/me.echeung.moemoekyun.fdroid.yml index 3e432d995b..4ad07a4f48 100644 --- a/metadata/me.echeung.moemoekyun.fdroid.yml +++ b/metadata/me.echeung.moemoekyun.fdroid.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/LISTEN-moe/android-app/issues Donate: https://www.patreon.com/odysseyradio AutoName: LISTEN.moe -Summary: Listen to j-pop and anime music radio 24/7 ad-free Description: |- Features: diff --git a/metadata/me.echeung.moemoekyun.fdroid/en-US/summary.txt b/metadata/me.echeung.moemoekyun.fdroid/en-US/summary.txt new file mode 100644 index 0000000000..5d7c57dc8e --- /dev/null +++ b/metadata/me.echeung.moemoekyun.fdroid/en-US/summary.txt @@ -0,0 +1 @@ +Listen to j-pop and anime music radio 24/7 ad-free diff --git a/metadata/me.guillaumin.android.osmtracker.yml b/metadata/me.guillaumin.android.osmtracker.yml index 5f0b4dbaaf..f527c546d0 100644 --- a/metadata/me.guillaumin.android.osmtracker.yml +++ b/metadata/me.guillaumin.android.osmtracker.yml @@ -7,7 +7,6 @@ Changelog: https://github.com/labexp/osmtracker-android/releases Name: OSMTracker AutoName: OSMTracker for Android™ -Summary: GPS Track Recorder Description: |- Notice: The app developer changed the applicationID, the new updated app is [[net.osmtracker]] diff --git a/metadata/me.guillaumin.android.osmtracker/en-US/summary.txt b/metadata/me.guillaumin.android.osmtracker/en-US/summary.txt new file mode 100644 index 0000000000..8354e21f9d --- /dev/null +++ b/metadata/me.guillaumin.android.osmtracker/en-US/summary.txt @@ -0,0 +1 @@ +GPS Track Recorder diff --git a/metadata/me.hda.urlhda.yml b/metadata/me.hda.urlhda.yml index 6be5911aea..012ff0947f 100644 --- a/metadata/me.hda.urlhda.yml +++ b/metadata/me.hda.urlhda.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/cryptofuture/urlhda-android/issues Bitcoin: 1N5czHaoSLukFSTq2ZJujaWGjkmBxv2dT9 AutoName: HDA URL -Summary: Generate short URLs Description: |- Generate short URLs for any given one via [http://hda.me hda.me]. [https://github.com/cryptofuture/urlhda Urlhda] repo also includes instruction diff --git a/metadata/me.hda.urlhda/en-US/summary.txt b/metadata/me.hda.urlhda/en-US/summary.txt new file mode 100644 index 0000000000..d92cb93875 --- /dev/null +++ b/metadata/me.hda.urlhda/en-US/summary.txt @@ -0,0 +1 @@ +Generate short URLs diff --git a/metadata/me.jakelane.wrapperforfacebook.yml b/metadata/me.jakelane.wrapperforfacebook.yml index 293cbfbb68..e15ebcda16 100644 --- a/metadata/me.jakelane.wrapperforfacebook.yml +++ b/metadata/me.jakelane.wrapperforfacebook.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/JakeLane/Toffeed IssueTracker: https://github.com/JakeLane/Toffeed/issues AutoName: Toffeed -Summary: Interact with Facebook Description: |- '''Note:''' This app is no longer maintained. diff --git a/metadata/me.jakelane.wrapperforfacebook/en-US/summary.txt b/metadata/me.jakelane.wrapperforfacebook/en-US/summary.txt new file mode 100644 index 0000000000..31308c6fe1 --- /dev/null +++ b/metadata/me.jakelane.wrapperforfacebook/en-US/summary.txt @@ -0,0 +1 @@ +Interact with Facebook diff --git a/metadata/me.jamesfrost.simpledo.yml b/metadata/me.jamesfrost.simpledo.yml index 312ddf8c9a..b664bfc31c 100644 --- a/metadata/me.jamesfrost.simpledo.yml +++ b/metadata/me.jamesfrost.simpledo.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/JamesFrost/SimpleDo IssueTracker: https://github.com/JamesFrost/SimpleDo/issues AutoName: SimpleDo -Summary: Track and manage todo items Description: Simple todo list manager with emphasis on minimalism. RepoType: git diff --git a/metadata/me.jamesfrost.simpledo/en-US/summary.txt b/metadata/me.jamesfrost.simpledo/en-US/summary.txt new file mode 100644 index 0000000000..9e347f8b4c --- /dev/null +++ b/metadata/me.jamesfrost.simpledo/en-US/summary.txt @@ -0,0 +1 @@ +Track and manage todo items diff --git a/metadata/me.johnmh.boogdroid.yml b/metadata/me.johnmh.boogdroid.yml index 41a6ec1116..e6df42cc30 100644 --- a/metadata/me.johnmh.boogdroid.yml +++ b/metadata/me.johnmh.boogdroid.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/JohnMH/BoogDroid IssueTracker: https://github.com/JohnMH/BoogDroid/issues AutoName: BoogDroid -Summary: Bugzilla client Description: Browse bugzilla bug tracker. RepoType: git diff --git a/metadata/me.johnmh.boogdroid/en-US/summary.txt b/metadata/me.johnmh.boogdroid/en-US/summary.txt new file mode 100644 index 0000000000..9858d490f7 --- /dev/null +++ b/metadata/me.johnmh.boogdroid/en-US/summary.txt @@ -0,0 +1 @@ +Bugzilla client diff --git a/metadata/me.kuehle.carreport.yml b/metadata/me.kuehle.carreport.yml index 4cb394f561..9dbc15c469 100644 --- a/metadata/me.kuehle.carreport.yml +++ b/metadata/me.kuehle.carreport.yml @@ -7,7 +7,6 @@ SourceCode: https://bitbucket.org/frigus02/car-report/src IssueTracker: https://bitbucket.org/frigus02/car-report/issues AutoName: Car Report -Summary: Track your car costs Description: |- Get an idea of how much your car costs. Simply enter the costs after refueling and get nice reports. These are: diff --git a/metadata/me.kuehle.carreport/en-US/summary.txt b/metadata/me.kuehle.carreport/en-US/summary.txt new file mode 100644 index 0000000000..e6f4060d3d --- /dev/null +++ b/metadata/me.kuehle.carreport/en-US/summary.txt @@ -0,0 +1 @@ +Track your car costs diff --git a/metadata/me.malladi.dashcricket.yml b/metadata/me.malladi.dashcricket.yml index e93a659945..247eb36d3f 100644 --- a/metadata/me.malladi.dashcricket.yml +++ b/metadata/me.malladi.dashcricket.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/mvsastry/dashcricket/issues Name: 'DashClock: DashCricket' AutoName: DashCricket - DashClock Live Cricket Scores Extension -Summary: Cricket scores on the lock-screen Description: |- [[net.nurik.roman.dashclock]] extension that displays cricket match scores from all around the world. diff --git a/metadata/me.malladi.dashcricket/en-US/summary.txt b/metadata/me.malladi.dashcricket/en-US/summary.txt new file mode 100644 index 0000000000..acbcff3135 --- /dev/null +++ b/metadata/me.malladi.dashcricket/en-US/summary.txt @@ -0,0 +1 @@ +Cricket scores on the lock-screen diff --git a/metadata/me.murks.filmchecker.yml b/metadata/me.murks.filmchecker.yml index 3767f2a171..035d3b1331 100644 --- a/metadata/me.murks.filmchecker.yml +++ b/metadata/me.murks.filmchecker.yml @@ -8,7 +8,6 @@ SourceCode: https://github.com/zouroboros/filmchecker IssueTracker: https://github.com/zouroboros/filmchecker/issues AutoName: FilmChecker -Summary: Checks the status of photo orders Description: |- Checks the status of photo orders. Currently only Rossmann (only in Germany) and DM (Germany and Austria) are supported. diff --git a/metadata/me.murks.filmchecker/en-US/summary.txt b/metadata/me.murks.filmchecker/en-US/summary.txt new file mode 100644 index 0000000000..68309d2d4d --- /dev/null +++ b/metadata/me.murks.filmchecker/en-US/summary.txt @@ -0,0 +1 @@ +Checks the status of photo orders diff --git a/metadata/me.phh.superuser.yml b/metadata/me.phh.superuser.yml index a47df09895..ddc3b19a37 100644 --- a/metadata/me.phh.superuser.yml +++ b/metadata/me.phh.superuser.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/phhusson/Superuser IssueTracker: https://github.com/phhusson/Superuser/issues AutoName: Superuser -Summary: Manage root access Description: |- An app to allow or forbid apps' requests to run as root. Note that this app doesn't include the '''su''' binary, so your device must already be rooted. diff --git a/metadata/me.phh.superuser/en-US/summary.txt b/metadata/me.phh.superuser/en-US/summary.txt new file mode 100644 index 0000000000..e0e1345ee6 --- /dev/null +++ b/metadata/me.phh.superuser/en-US/summary.txt @@ -0,0 +1 @@ +Manage root access diff --git a/metadata/me.sheimi.sgit.yml b/metadata/me.sheimi.sgit.yml index 9dca7eab6b..4c38be236e 100644 --- a/metadata/me.sheimi.sgit.yml +++ b/metadata/me.sheimi.sgit.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/sheimi/SGit/issues Donate: http://projects.sheimi.me/SGit AutoName: SGit -Summary: Git Client Description: |- This app has been deprecated by upstream in favor of [[com.manichord.mgit]]. diff --git a/metadata/me.sheimi.sgit/en-US/summary.txt b/metadata/me.sheimi.sgit/en-US/summary.txt new file mode 100644 index 0000000000..30d5a3ab1d --- /dev/null +++ b/metadata/me.sheimi.sgit/en-US/summary.txt @@ -0,0 +1 @@ +Git Client diff --git a/metadata/me.shrimadhavuk.numselapp.yml b/metadata/me.shrimadhavuk.numselapp.yml index be9ab137b3..76b4cb6ed6 100644 --- a/metadata/me.shrimadhavuk.numselapp.yml +++ b/metadata/me.shrimadhavuk.numselapp.yml @@ -8,7 +8,6 @@ Donate: https://www.instamojo.com/@spechide/ Bitcoin: 13csS5SByVR4e3tJ9c4gjC18Lua8dXDp9A AutoName: NoWhatOpen -Summary: Clickable links for WhatsApp Description: |- This application is a plugin to the existing popular Internet Messaging Application called WhatsApp, it is useless by itself. It makes clickable links diff --git a/metadata/me.shrimadhavuk.numselapp/en-US/summary.txt b/metadata/me.shrimadhavuk.numselapp/en-US/summary.txt new file mode 100644 index 0000000000..bc46aef1bc --- /dev/null +++ b/metadata/me.shrimadhavuk.numselapp/en-US/summary.txt @@ -0,0 +1 @@ +Clickable links for WhatsApp diff --git a/metadata/me.shrimadhavuk.watransmitter.yml b/metadata/me.shrimadhavuk.watransmitter.yml index 6e6e0526b0..66bd7ded6f 100644 --- a/metadata/me.shrimadhavuk.watransmitter.yml +++ b/metadata/me.shrimadhavuk.watransmitter.yml @@ -9,7 +9,6 @@ SourceCode: https://github.com/SpEcHiDe/WhatsAppTransmitter IssueTracker: https://github.com/SpEcHiDe/WhatsAppTransmitter/issues AutoName: WATransmitter -Summary: Share any file in WhatsApp Description: |- Send any type of file using the popular internet messaging service WhatsApp. This is achieved by uploading the file to a thirdparty server from where the diff --git a/metadata/me.shrimadhavuk.watransmitter/en-US/summary.txt b/metadata/me.shrimadhavuk.watransmitter/en-US/summary.txt new file mode 100644 index 0000000000..e44b096260 --- /dev/null +++ b/metadata/me.shrimadhavuk.watransmitter/en-US/summary.txt @@ -0,0 +1 @@ +Share any file in WhatsApp diff --git a/metadata/me.tripsit.tripmobile.yml b/metadata/me.tripsit.tripmobile.yml index 6e03d04135..0cba7a085d 100644 --- a/metadata/me.tripsit.tripmobile.yml +++ b/metadata/me.tripsit.tripmobile.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/TripSit/tripmobile/issues Bitcoin: 1EDqf32gw73tc1WtgdT2FymfmDN4RyC9RN AutoName: TripSit -Summary: Information, combination charts and a live help chat for recreational drugs Description: |- Brought to you by TripSit, an organisation leading the online harm reduction community, this app provides a substantial amount of content intended to help diff --git a/metadata/me.tripsit.tripmobile/en-US/summary.txt b/metadata/me.tripsit.tripmobile/en-US/summary.txt new file mode 100644 index 0000000000..022f48902c --- /dev/null +++ b/metadata/me.tripsit.tripmobile/en-US/summary.txt @@ -0,0 +1 @@ +Information, combination charts and a live help chat for recreational drugs diff --git a/metadata/me.tsukanov.counter.yml b/metadata/me.tsukanov.counter.yml index 5623f17402..55180cc163 100644 --- a/metadata/me.tsukanov.counter.yml +++ b/metadata/me.tsukanov.counter.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/gentlecat/Simple-Counter/issues Changelog: https://github.com/gentlecat/Simple-Counter/blob/HEAD/CHANGELOG.md AutoName: Counter -Summary: Tally counter Description: |- Tally counter that makes counting easier. You can have multiple counters with their own names and values. Values can be changed using volume buttons. diff --git a/metadata/me.tsukanov.counter/en-US/summary.txt b/metadata/me.tsukanov.counter/en-US/summary.txt new file mode 100644 index 0000000000..97ef2e0f37 --- /dev/null +++ b/metadata/me.tsukanov.counter/en-US/summary.txt @@ -0,0 +1 @@ +Tally counter diff --git a/metadata/me.writeily.yml b/metadata/me.writeily.yml index 0465ae273f..463e505722 100644 --- a/metadata/me.writeily.yml +++ b/metadata/me.writeily.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/plafue/writeily-pro IssueTracker: https://github.com/plafue/writeily-pro/issues AutoName: Writeily Pro -Summary: Edit markdown files Description: |- Simply and elegantly compose notes in markdown or plain text. Organize by folders, save and access files from external storage, and restrict access with a diff --git a/metadata/me.writeily/en-US/summary.txt b/metadata/me.writeily/en-US/summary.txt new file mode 100644 index 0000000000..3940804d3d --- /dev/null +++ b/metadata/me.writeily/en-US/summary.txt @@ -0,0 +1 @@ +Edit markdown files diff --git a/metadata/me.zeeroooo.materialfb.yml b/metadata/me.zeeroooo.materialfb.yml index 07451212fa..5b2fcb0858 100644 --- a/metadata/me.zeeroooo.materialfb.yml +++ b/metadata/me.zeeroooo.materialfb.yml @@ -8,7 +8,6 @@ IssueTracker: https://github.com/ZeeRooo/MaterialFBook/issues Changelog: https://github.com/ZeeRooo/MaterialFBook/blob/HEAD/README.md#changelog AutoName: MaterialFBook -Summary: Browse Facebook Description: |- Wrapper around Facebook's mobile website and APIs, based on [[me.jakelane.wrapperforfacebook]]. diff --git a/metadata/me.zeeroooo.materialfb/en-US/summary.txt b/metadata/me.zeeroooo.materialfb/en-US/summary.txt new file mode 100644 index 0000000000..b71399609b --- /dev/null +++ b/metadata/me.zeeroooo.materialfb/en-US/summary.txt @@ -0,0 +1 @@ +Browse Facebook diff --git a/metadata/menion.android.whereyougo.yml b/metadata/menion.android.whereyougo.yml index 2eab65bc15..b129807d2c 100644 --- a/metadata/menion.android.whereyougo.yml +++ b/metadata/menion.android.whereyougo.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/biylda/WhereYouGo IssueTracker: https://github.com/biylda/WhereYouGo/issues AutoName: WhereYouGo -Summary: Whereigo client Description: |- WhereYouGo is an unofficial client for Wherigo Geocaching. It displays online and offline vector maps using Mapsforge library, alternatively Locus can be used diff --git a/metadata/menion.android.whereyougo/en-US/summary.txt b/metadata/menion.android.whereyougo/en-US/summary.txt new file mode 100644 index 0000000000..cd9d07bb4f --- /dev/null +++ b/metadata/menion.android.whereyougo/en-US/summary.txt @@ -0,0 +1 @@ +Whereigo client diff --git a/metadata/mixedbit.speechtrainer.yml b/metadata/mixedbit.speechtrainer.yml index 5f46608c4d..d381052e1f 100644 --- a/metadata/mixedbit.speechtrainer.yml +++ b/metadata/mixedbit.speechtrainer.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/wrr/speech_trainer IssueTracker: https://github.com/wrr/speech_trainer/issues AutoName: Speech Trainer -Summary: Speech training Description: |- Gives immediate feedback on the sound of your voice for training pronunciation, articulation and diction. A useful aid for learning foreign languages or diff --git a/metadata/mixedbit.speechtrainer/en-US/summary.txt b/metadata/mixedbit.speechtrainer/en-US/summary.txt new file mode 100644 index 0000000000..b96cacbff5 --- /dev/null +++ b/metadata/mixedbit.speechtrainer/en-US/summary.txt @@ -0,0 +1 @@ +Speech training diff --git a/metadata/mkg20001.net.samremote.yml b/metadata/mkg20001.net.samremote.yml index d230f844ef..4faa902dce 100644 --- a/metadata/mkg20001.net.samremote.yml +++ b/metadata/mkg20001.net.samremote.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/mkg20001/SamRemote/issues Changelog: https://github.com/mkg20001/SamRemote/releases AutoName: Sam Remote -Summary: Simple WiFi remote for Samsung TVs Description: |- Control your Samsung TV with SamRemote diff --git a/metadata/mkg20001.net.samremote/en-US/summary.txt b/metadata/mkg20001.net.samremote/en-US/summary.txt new file mode 100644 index 0000000000..4145c4e1dd --- /dev/null +++ b/metadata/mkg20001.net.samremote/en-US/summary.txt @@ -0,0 +1 @@ +Simple WiFi remote for Samsung TVs diff --git a/metadata/mobi.boilr.boilr.yml b/metadata/mobi.boilr.boilr.yml index 682eb3ca32..066a723ece 100644 --- a/metadata/mobi.boilr.boilr.yml +++ b/metadata/mobi.boilr.boilr.yml @@ -8,7 +8,6 @@ Donate: http://boilr.mobi#donate Bitcoin: 1PHuSWfuAwR6oz9qV93rTdMVozfM85Qqxx AutoName: Boilr -Summary: Pricealarm for Bitcoin, altcoins, assets & futures Description: |- Monitor Bitcoin, cryptocurrencies, cryptoassets, futures and options, and trigger alarms according to user settings. 90+ exchanges and counting. diff --git a/metadata/mobi.boilr.boilr/en-US/summary.txt b/metadata/mobi.boilr.boilr/en-US/summary.txt new file mode 100644 index 0000000000..11b99adfbc --- /dev/null +++ b/metadata/mobi.boilr.boilr/en-US/summary.txt @@ -0,0 +1 @@ +Pricealarm for Bitcoin, altcoins, assets & futures diff --git a/metadata/mobi.cyann.nstools.yml b/metadata/mobi.cyann.nstools.yml index ee6be0dc74..b92c7ed2c6 100644 --- a/metadata/mobi.cyann.nstools.yml +++ b/metadata/mobi.cyann.nstools.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/arifhn/nstools IssueTracker: https://github.com/arifhn/nstools/issues AutoName: NSTools -Summary: Manage kernel tweaks for Nexus S Description: |- Manage BLX,BLN,Deep Idle,Governor and voltage settings for custom kernels. Relevant for most custom kernels on the i9020 and i9023, Crespo and Crespo 4g. diff --git a/metadata/mobi.cyann.nstools/en-US/summary.txt b/metadata/mobi.cyann.nstools/en-US/summary.txt new file mode 100644 index 0000000000..29ab6f3b81 --- /dev/null +++ b/metadata/mobi.cyann.nstools/en-US/summary.txt @@ -0,0 +1 @@ +Manage kernel tweaks for Nexus S diff --git a/metadata/mobi.maptrek.yml b/metadata/mobi.maptrek.yml index 449ac61a90..cd11347ffe 100644 --- a/metadata/mobi.maptrek.yml +++ b/metadata/mobi.maptrek.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/andreynovikov/trekarta IssueTracker: https://github.com/andreynovikov/trekarta/issues AutoName: Trekarta -Summary: Simple, responsive map for your trek Description: Trekarta (former MapTrek) is designed for hiking, geocaching, off-roading, cycling, boating and all other outdoor activities. It uses offline maps so you do not need to have internet connection. You can easily import places and tracks diff --git a/metadata/mobi.maptrek/en-US/summary.txt b/metadata/mobi.maptrek/en-US/summary.txt new file mode 100644 index 0000000000..784a5ae4f8 --- /dev/null +++ b/metadata/mobi.maptrek/en-US/summary.txt @@ -0,0 +1 @@ +Simple, responsive map for your trek diff --git a/metadata/mobi.omegacentauri.PerApp.yml b/metadata/mobi.omegacentauri.PerApp.yml index 49d95d5d05..8157dd35b0 100644 --- a/metadata/mobi.omegacentauri.PerApp.yml +++ b/metadata/mobi.omegacentauri.PerApp.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/arpruss/perapp/issues Donate: http://forum.xda-developers.com/donatetome.php?u=2714177 AutoName: PerApp -Summary: Separate settings for each app Description: |- Easily extendable per-app settings app for Android. Orientation lock, screen timeout, volume and more can be adjusted. diff --git a/metadata/mobi.omegacentauri.PerApp/en-US/summary.txt b/metadata/mobi.omegacentauri.PerApp/en-US/summary.txt new file mode 100644 index 0000000000..a2273e6b05 --- /dev/null +++ b/metadata/mobi.omegacentauri.PerApp/en-US/summary.txt @@ -0,0 +1 @@ +Separate settings for each app diff --git a/metadata/mobi.omegacentauri.SendReduced.yml b/metadata/mobi.omegacentauri.SendReduced.yml index db7cd33f40..9669ee3e8e 100644 --- a/metadata/mobi.omegacentauri.SendReduced.yml +++ b/metadata/mobi.omegacentauri.SendReduced.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/arpruss/sendreduced/issues Name: Send Reduced AutoName: Send Reduced Free -Summary: Reduce image size Description: |- Take full resolution images with your camera and share them to this app which will reduce the size again before being sent. Share via the gallery or via the diff --git a/metadata/mobi.omegacentauri.SendReduced/en-US/summary.txt b/metadata/mobi.omegacentauri.SendReduced/en-US/summary.txt new file mode 100644 index 0000000000..8064a34856 --- /dev/null +++ b/metadata/mobi.omegacentauri.SendReduced/en-US/summary.txt @@ -0,0 +1 @@ +Reduce image size diff --git a/metadata/moe.feng.nhentai.yml b/metadata/moe.feng.nhentai.yml index 80df54681f..2204defeea 100644 --- a/metadata/moe.feng.nhentai.yml +++ b/metadata/moe.feng.nhentai.yml @@ -8,7 +8,6 @@ IssueTracker: https://github.com/NHMoeDev/NHentai-android/issues Changelog: https://github.com/NHMoeDev/NHentai-android/releases AutoName: NHBooks -Summary: NHBooks is a Material Design NHentai client Description: |- The program provides a simple and elegant interface in accordance with the Material Design specification, and obtains the book from NHentai through the diff --git a/metadata/moe.feng.nhentai/en-US/summary.txt b/metadata/moe.feng.nhentai/en-US/summary.txt new file mode 100644 index 0000000000..800981239e --- /dev/null +++ b/metadata/moe.feng.nhentai/en-US/summary.txt @@ -0,0 +1 @@ +NHBooks is a Material Design NHentai client diff --git a/metadata/moe.martini.midictrl.yml b/metadata/moe.martini.midictrl.yml index 067a4ecd90..030b9d7482 100644 --- a/metadata/moe.martini.midictrl.yml +++ b/metadata/moe.martini.midictrl.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/MartiniMoe/MIDICtrl/issues Changelog: https://github.com/MartiniMoe/MIDICtrl/blob/HEAD/CHANGELOG.md AutoName: MIDICtrl -Summary: Control MIDI devices Description: |- Using the new MIDI API thats available on Android 6+, this app allows you to control your favourite DAW with your phone. diff --git a/metadata/moe.martini.midictrl/en-US/summary.txt b/metadata/moe.martini.midictrl/en-US/summary.txt new file mode 100644 index 0000000000..2d8a6b4fdd --- /dev/null +++ b/metadata/moe.martini.midictrl/en-US/summary.txt @@ -0,0 +1 @@ +Control MIDI devices diff --git a/metadata/moe.minori.pgpclipper.yml b/metadata/moe.minori.pgpclipper.yml index 103322cb3b..97c3973190 100644 --- a/metadata/moe.minori.pgpclipper.yml +++ b/metadata/moe.minori.pgpclipper.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/Mnkai/PGPClipper IssueTracker: https://github.com/Mnkai/PGPClipper/issues AutoName: PGPClipper -Summary: Add PGP support via clipboard Description: |- Use PGPClipper to easily and safely write and receive PGP messages in apps that let you copy and paste text. diff --git a/metadata/moe.minori.pgpclipper/en-US/summary.txt b/metadata/moe.minori.pgpclipper/en-US/summary.txt new file mode 100644 index 0000000000..9f09cf13a4 --- /dev/null +++ b/metadata/moe.minori.pgpclipper/en-US/summary.txt @@ -0,0 +1 @@ +Add PGP support via clipboard diff --git a/metadata/mohammad.adib.roundr.yml b/metadata/mohammad.adib.roundr.yml index cac08ef89c..1cc7d99604 100644 --- a/metadata/mohammad.adib.roundr.yml +++ b/metadata/mohammad.adib.roundr.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/MohammadAdib/RoundR IssueTracker: https://github.com/MohammadAdib/RoundR/issues AutoName: RoundR -Summary: Round the corners of the screen Description: |- RoundR takes advantage of the fact that regardless of the device's color, the screen is surrounded with a pitch black border, the corners of which are rarely diff --git a/metadata/mohammad.adib.roundr/en-US/summary.txt b/metadata/mohammad.adib.roundr/en-US/summary.txt new file mode 100644 index 0000000000..778f0d1772 --- /dev/null +++ b/metadata/mohammad.adib.roundr/en-US/summary.txt @@ -0,0 +1 @@ +Round the corners of the screen diff --git a/metadata/monakhv.android.samlib.yml b/metadata/monakhv.android.samlib.yml index 75e51949b4..78461c245a 100644 --- a/metadata/monakhv.android.samlib.yml +++ b/metadata/monakhv.android.samlib.yml @@ -8,7 +8,6 @@ SourceCode: https://github.com/monakhv/samlib-Info IssueTracker: https://github.com/monakhv/samlib-Info/issues AutoName: SamLib Инфо -Summary: Track new Russian publications Description: |- New publications on samlib.ru site. diff --git a/metadata/monakhv.android.samlib/en-US/summary.txt b/metadata/monakhv.android.samlib/en-US/summary.txt new file mode 100644 index 0000000000..13bd504006 --- /dev/null +++ b/metadata/monakhv.android.samlib/en-US/summary.txt @@ -0,0 +1 @@ +Track new Russian publications diff --git a/metadata/mono.hg.yml b/metadata/mono.hg.yml index c1eceacfde..1daffc1fac 100644 --- a/metadata/mono.hg.yml +++ b/metadata/mono.hg.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/F4uzan/HgLauncher/issues Changelog: https://github.com/F4uzan/HgLauncher/releases AutoName: HgLauncher -Summary: A launcher for a slow day Description: HgLauncher is a launcher with a design philosophy of 'if it works, it works.' Consisting of simply a scrolling list of apps, there is very little visual cue to disturb you. If all you want in a launcher is for it to just launch apps diff --git a/metadata/mono.hg/en-US/summary.txt b/metadata/mono.hg/en-US/summary.txt new file mode 100644 index 0000000000..29491a0c77 --- /dev/null +++ b/metadata/mono.hg/en-US/summary.txt @@ -0,0 +1 @@ +A launcher for a slow day diff --git a/metadata/name.gdr.acastus_photon.yml b/metadata/name.gdr.acastus_photon.yml index 7ddf35a2c5..041536fa86 100644 --- a/metadata/name.gdr.acastus_photon.yml +++ b/metadata/name.gdr.acastus_photon.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/gjedeer/Acastus IssueTracker: https://github.com/gjedeer/Acastus/issues AutoName: Acastus Photon -Summary: An online address/POI search for navigation apps Description: |- A private, free and open source replacement for Google Maps and other geocoding services that relies on Photon, which you diff --git a/metadata/name.gdr.acastus_photon/en-US/summary.txt b/metadata/name.gdr.acastus_photon/en-US/summary.txt new file mode 100644 index 0000000000..2ec9f1665d --- /dev/null +++ b/metadata/name.gdr.acastus_photon/en-US/summary.txt @@ -0,0 +1 @@ +An online address/POI search for navigation apps diff --git a/metadata/namlit.siteswapgenerator.yml b/metadata/namlit.siteswapgenerator.yml index 776643973d..824b94aeb7 100644 --- a/metadata/namlit.siteswapgenerator.yml +++ b/metadata/namlit.siteswapgenerator.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/namlit/siteswap_generator IssueTracker: https://github.com/namlit/siteswap_generator/issues AutoName: Siteswap Generator -Summary: Generate juggling siteswaps for passing Description: |- The Siteswap Generator is designed for passing Siteswap generation and analysis. The following features are supported: * Find all possible Siteswaps for a given period length and number of objects diff --git a/metadata/namlit.siteswapgenerator/en-US/summary.txt b/metadata/namlit.siteswapgenerator/en-US/summary.txt new file mode 100644 index 0000000000..ff98ca6172 --- /dev/null +++ b/metadata/namlit.siteswapgenerator/en-US/summary.txt @@ -0,0 +1 @@ +Generate juggling siteswaps for passing diff --git a/metadata/negativedensity.techahashi.yml b/metadata/negativedensity.techahashi.yml index 33d27a4ed4..3fd2367f2e 100644 --- a/metadata/negativedensity.techahashi.yml +++ b/metadata/negativedensity.techahashi.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/negativedensity/techahashi IssueTracker: https://github.com/negativedensity/techahashi/issues AutoName: Techahashi -Summary: Minimal presentation tool, Takahashi method with technical upgrades Description: | A fork of [[trikita.slide]]. diff --git a/metadata/negativedensity.techahashi/en-US/summary.txt b/metadata/negativedensity.techahashi/en-US/summary.txt new file mode 100644 index 0000000000..cbf79bb102 --- /dev/null +++ b/metadata/negativedensity.techahashi/en-US/summary.txt @@ -0,0 +1 @@ +Minimal presentation tool, Takahashi method with technical upgrades diff --git a/metadata/net.asceai.meritous.yml b/metadata/net.asceai.meritous.yml index f4f3afa537..4d97217869 100644 --- a/metadata/net.asceai.meritous.yml +++ b/metadata/net.asceai.meritous.yml @@ -6,7 +6,6 @@ AuthorEmail: beuc@beuc.net WebSite: http://asceai.net/meritous SourceCode: https://gitlab.com/meritous -Summary: Dungeon crawl game Description: |- Far below the surface of the planet is a secret. A place of limitless power. Those that seek to control such a utopia will soon bring an end to themselves. Seeking an end to the troubles that plague him, PSI user MERIT journeys into the hallowed Orcus Dome in search of answers. Meritous is a action-adventure game with simple controls but a challenge to find a balance of power verses recovery time during real-time battles. Set in a fractually-generated world, the player can explore thousands of rooms in search of powerful artifacts, tools to help them, and to eventually free the Orcus Dome from evil. . diff --git a/metadata/net.asceai.meritous/en-US/summary.txt b/metadata/net.asceai.meritous/en-US/summary.txt new file mode 100644 index 0000000000..d5bdfc5fe9 --- /dev/null +++ b/metadata/net.asceai.meritous/en-US/summary.txt @@ -0,0 +1 @@ +Dungeon crawl game diff --git a/metadata/net.opendasharchive.openarchive.release.yml b/metadata/net.opendasharchive.openarchive.release.yml index e311f9813c..ec2df1339e 100644 --- a/metadata/net.opendasharchive.openarchive.release.yml +++ b/metadata/net.opendasharchive.openarchive.release.yml @@ -9,7 +9,6 @@ SourceCode: https://github.com/OpenArchive/openarchive-android IssueTracker: https://github.com/OpenArchive/openarchive-android/issues AutoName: OpenArchive -Summary: Organize and share media Description: | Add metadata and Creative Commons licensing to your audiovisual media and then send it to the Internet Archive via Tor. It offers diff --git a/metadata/net.opendasharchive.openarchive.release/en-US/summary.txt b/metadata/net.opendasharchive.openarchive.release/en-US/summary.txt new file mode 100644 index 0000000000..bca507bc38 --- /dev/null +++ b/metadata/net.opendasharchive.openarchive.release/en-US/summary.txt @@ -0,0 +1 @@ +Organize and share media diff --git a/metadata/net.pp3345.ykdroid.yml b/metadata/net.pp3345.ykdroid.yml index b0ff89d858..a97c291403 100644 --- a/metadata/net.pp3345.ykdroid.yml +++ b/metadata/net.pp3345.ykdroid.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/pp3345/ykDroid/issues Changelog: https://github.com/pp3345/ykDroid/releases AutoName: ykDroid -Summary: YubiKey challenge-response USB and NFC driver Description: |- ''ykDroid'' is a USB and NFC driver for Android that exposes the challenge-response feature of YubiKeys for use by other Android apps. Both diff --git a/metadata/net.pp3345.ykdroid/en-US/summary.txt b/metadata/net.pp3345.ykdroid/en-US/summary.txt new file mode 100644 index 0000000000..fd00920216 --- /dev/null +++ b/metadata/net.pp3345.ykdroid/en-US/summary.txt @@ -0,0 +1 @@ +YubiKey challenge-response USB and NFC driver diff --git a/metadata/net.schueller.peertube.yml b/metadata/net.schueller.peertube.yml index ad876af709..4f6c1c36c9 100644 --- a/metadata/net.schueller.peertube.yml +++ b/metadata/net.schueller.peertube.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/sschueller/peertube-android/issues Changelog: https://raw.githubusercontent.com/sschueller/peertube-android/HEAD/CHANGELOG.md AutoName: Thorium -Summary: a PeerTube player Description: | PeerTube is a federated video streaming platform that is community-owned and ad-free, with no vendor lock-in. This client allows you to watch and browse videos on a server of your choice in the PeerTube network. diff --git a/metadata/net.schueller.peertube/en-US/summary.txt b/metadata/net.schueller.peertube/en-US/summary.txt new file mode 100644 index 0000000000..c98502e415 --- /dev/null +++ b/metadata/net.schueller.peertube/en-US/summary.txt @@ -0,0 +1 @@ +a PeerTube player diff --git a/metadata/net.typeblog.shelter.yml b/metadata/net.typeblog.shelter.yml index 868ca170dc..94160de22b 100644 --- a/metadata/net.typeblog.shelter.yml +++ b/metadata/net.typeblog.shelter.yml @@ -8,7 +8,6 @@ IssueTracker: https://git.angry.im/PeterCxy/Shelter/issues Changelog: https://git.angry.im/PeterCxy/Shelter/releases AutoName: Shelter -Summary: Isolate your Big Brother Apps / Multiple Accounts Description: | PLEASE READ [https://git.angry.im/PeterCxy/Shelter/src/branch/master/README.md README.md] BEFORE YOU START USING THIS APP! diff --git a/metadata/net.typeblog.shelter/en-US/summary.txt b/metadata/net.typeblog.shelter/en-US/summary.txt new file mode 100644 index 0000000000..6b4bdacc12 --- /dev/null +++ b/metadata/net.typeblog.shelter/en-US/summary.txt @@ -0,0 +1 @@ +Isolate your Big Brother Apps / Multiple Accounts diff --git a/metadata/nl.devluuk.sleepywifi.yml b/metadata/nl.devluuk.sleepywifi.yml index 7044d07f0c..adb7cac66c 100644 --- a/metadata/nl.devluuk.sleepywifi.yml +++ b/metadata/nl.devluuk.sleepywifi.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/DevLuuk/SleepyWifi/issues Changelog: https://github.com/DevLuuk/SleepyWifi/releases AutoName: SleepyWifi -Summary: Disables the Wi-Fi when the phone is in sleep mode Description: |- This app brings back the 'turn Wi-Fi off when the phone is in sleepmode' option for Android 8.1. This app can also save your phone battery. diff --git a/metadata/nl.devluuk.sleepywifi/en-US/summary.txt b/metadata/nl.devluuk.sleepywifi/en-US/summary.txt new file mode 100644 index 0000000000..fe32b6976c --- /dev/null +++ b/metadata/nl.devluuk.sleepywifi/en-US/summary.txt @@ -0,0 +1 @@ +Disables the Wi-Fi when the phone is in sleep mode diff --git a/metadata/nl.eventinfra.wifisetup.yml b/metadata/nl.eventinfra.wifisetup.yml index 97b6acf939..c248eaf2ec 100644 --- a/metadata/nl.eventinfra.wifisetup.yml +++ b/metadata/nl.eventinfra.wifisetup.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/EventInfra/wifisetup IssueTracker: https://github.com/EventInfra/wifisetup/issues AutoName: 35C3 Wifi Setup -Summary: Official NOC application for connecting to the 35C3 WiFi Description: | This app creates a secure profile with CA certificate checking (Let's Encrypt) and certificate subject verification (radius.c3noc.net), with simply diff --git a/metadata/nl.eventinfra.wifisetup/en-US/summary.txt b/metadata/nl.eventinfra.wifisetup/en-US/summary.txt new file mode 100644 index 0000000000..492b10de8a --- /dev/null +++ b/metadata/nl.eventinfra.wifisetup/en-US/summary.txt @@ -0,0 +1 @@ +Official NOC application for connecting to the 35C3 WiFi diff --git a/metadata/nodomain.freeyourgadget.tpmsmonitor.yml b/metadata/nodomain.freeyourgadget.tpmsmonitor.yml index c086a83bf3..dbcce5bb8f 100644 --- a/metadata/nodomain.freeyourgadget.tpmsmonitor.yml +++ b/metadata/nodomain.freeyourgadget.tpmsmonitor.yml @@ -6,7 +6,6 @@ SourceCode: https://codeberg.org/Freeyourgadget/TpmsMonitor IssueTracker: https://codeberg.org/Freeyourgadget/TpmsMonitor/issues AutoName: TpmsMonitor -Summary: Manage Bluetooth tire pressure monitor sensors Description: | TpmsMonitor allows to parse, show and store pressure and temperature as received by Bluetooth Low Energy tire pressure monitor sensors (TPMS). diff --git a/metadata/nodomain.freeyourgadget.tpmsmonitor/en-US/summary.txt b/metadata/nodomain.freeyourgadget.tpmsmonitor/en-US/summary.txt new file mode 100644 index 0000000000..d9d28a3113 --- /dev/null +++ b/metadata/nodomain.freeyourgadget.tpmsmonitor/en-US/summary.txt @@ -0,0 +1 @@ +Manage Bluetooth tire pressure monitor sensors diff --git a/metadata/opencontacts.open.com.opencontacts.yml b/metadata/opencontacts.open.com.opencontacts.yml index ce84209f5f..5445229ab9 100644 --- a/metadata/opencontacts.open.com.opencontacts.yml +++ b/metadata/opencontacts.open.com.opencontacts.yml @@ -7,7 +7,6 @@ IssueTracker: https://gitlab.com/sultanahamer/OpenContacts/issues Changelog: https://gitlab.com/sultanahamer/OpenContacts/blob/HEAD/CHANGELOG AutoName: OpenContacts -Summary: Hide contacts away from apps stealing your contacts information Description: | Even though we are not having any problem sharing our mobile number with all third parties, people in our phone book might have. We should not be sharing their contact information online. So, keep your contacts safe in a different database. This app saves contacts in its own database seperate from android contacts. This way no other app would be able to access contacts. diff --git a/metadata/opencontacts.open.com.opencontacts/en-US/summary.txt b/metadata/opencontacts.open.com.opencontacts/en-US/summary.txt new file mode 100644 index 0000000000..1cc89e36f7 --- /dev/null +++ b/metadata/opencontacts.open.com.opencontacts/en-US/summary.txt @@ -0,0 +1 @@ +Hide contacts away from apps stealing your contacts information diff --git a/metadata/org.atai.TessUI.yml b/metadata/org.atai.TessUI.yml index c85c3fd8c1..d19a42447d 100644 --- a/metadata/org.atai.TessUI.yml +++ b/metadata/org.atai.TessUI.yml @@ -7,7 +7,6 @@ SourceCode: https://gitlab.com/character-recognition/character-recognition/tree/ IssueTracker: https://gitlab.com/character-recognition/character-recognition/issues AutoName: Character Recognition -Summary: Extract text from images Description: |- OCR software based on [https://code.google.com/p/tesseract-ocr/ Tesseract] library to perform character recognition on images selected from the gallery or diff --git a/metadata/org.atai.TessUI/en-US/summary.txt b/metadata/org.atai.TessUI/en-US/summary.txt new file mode 100644 index 0000000000..0edd3882f3 --- /dev/null +++ b/metadata/org.atai.TessUI/en-US/summary.txt @@ -0,0 +1 @@ +Extract text from images diff --git a/metadata/org.blitzortung.android.app.yml b/metadata/org.blitzortung.android.app.yml index 8eb36a81ae..eaa81dab9a 100644 --- a/metadata/org.blitzortung.android.app.yml +++ b/metadata/org.blitzortung.android.app.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/wuan/bo-android/issues Changelog: https://github.com/wuan/bo-android/blob/HEAD/ChangeLog AutoName: Blitzortung Lightning Monitor -Summary: Get an overview of the current thunderstorm situation Description: |- Simple to use map based application visualizing real time full area lightning data provided by the blitzortung.org lightning location network diff --git a/metadata/org.blitzortung.android.app/en-US/summary.txt b/metadata/org.blitzortung.android.app/en-US/summary.txt new file mode 100644 index 0000000000..59794b21d0 --- /dev/null +++ b/metadata/org.blitzortung.android.app/en-US/summary.txt @@ -0,0 +1 @@ +Get an overview of the current thunderstorm situation diff --git a/metadata/org.covolunablu.marswallpaper.yml b/metadata/org.covolunablu.marswallpaper.yml index f0201f3043..1f953f199e 100644 --- a/metadata/org.covolunablu.marswallpaper.yml +++ b/metadata/org.covolunablu.marswallpaper.yml @@ -7,7 +7,6 @@ IssueTracker: https://gitlab.com/portaloffreedom/MarsWallpaper/issues Donate: https://paypal.me/portaloffreedom AutoName: Mars Live Wallpaper -Summary: Rotating red planet Description: A realistic rendering of your favourite red planet on your home screen. No battery will be harmed by using this live wallpaper (just keep FPS low). diff --git a/metadata/org.covolunablu.marswallpaper/en-US/summary.txt b/metadata/org.covolunablu.marswallpaper/en-US/summary.txt new file mode 100644 index 0000000000..f5a491d447 --- /dev/null +++ b/metadata/org.covolunablu.marswallpaper/en-US/summary.txt @@ -0,0 +1 @@ +Rotating red planet diff --git a/metadata/org.decsync.cc.yml b/metadata/org.decsync.cc.yml index cb2f9efbee..8b844d086b 100644 --- a/metadata/org.decsync.cc.yml +++ b/metadata/org.decsync.cc.yml @@ -8,7 +8,6 @@ IssueTracker: https://github.com/39aldo39/DecSyncCC/issues Bitcoin: 1JWYoV2MZyu8LYYHCur9jUJgGqE98m566z AutoName: DecSync CC -Summary: Sync contacts and calendars without a server using DecSync Description: |- DecSync CC synchronizes contacts and calendars using [https://github.com/39aldo39/DecSync DecSync]. To start synchronizing, all diff --git a/metadata/org.decsync.cc/en-US/summary.txt b/metadata/org.decsync.cc/en-US/summary.txt new file mode 100644 index 0000000000..b80ae2c36e --- /dev/null +++ b/metadata/org.decsync.cc/en-US/summary.txt @@ -0,0 +1 @@ +Sync contacts and calendars without a server using DecSync diff --git a/metadata/org.decsync.sparss.floss.yml b/metadata/org.decsync.sparss.floss.yml index b5d6b6aeba..f05c1a326e 100644 --- a/metadata/org.decsync.sparss.floss.yml +++ b/metadata/org.decsync.sparss.floss.yml @@ -9,7 +9,6 @@ IssueTracker: https://github.com/39aldo39/spaRSS-DecSync/issues Bitcoin: 1JWYoV2MZyu8LYYHCur9jUJgGqE98m566z AutoName: spaRSS DecSync -Summary: Sync RSS without a server using DecSync Description: |- spaRSS DecSync is a fork of [[net.etuldan.sparss.floss]] which adds synchronization using [https://github.com/39aldo39/DecSync DecSync]. To diff --git a/metadata/org.decsync.sparss.floss/en-US/summary.txt b/metadata/org.decsync.sparss.floss/en-US/summary.txt new file mode 100644 index 0000000000..34f3300324 --- /dev/null +++ b/metadata/org.decsync.sparss.floss/en-US/summary.txt @@ -0,0 +1 @@ +Sync RSS without a server using DecSync diff --git a/metadata/org.droidtr.deletegapps.yml b/metadata/org.droidtr.deletegapps.yml index 059d5091ec..7897941aca 100644 --- a/metadata/org.droidtr.deletegapps.yml +++ b/metadata/org.droidtr.deletegapps.yml @@ -5,7 +5,6 @@ SourceCode: https://gitlab.com/parduscix/disable-delete-gapps IssueTracker: https://gitlab.com/parduscix/disable-delete-gapps/issues AutoName: /d/gapps -Summary: Delete/disable GApps Description: |- This application is used to delete or disable gapps. It uses a regex to find GApps package diff --git a/metadata/org.droidtr.deletegapps/en-US/summary.txt b/metadata/org.droidtr.deletegapps/en-US/summary.txt new file mode 100644 index 0000000000..741c08e614 --- /dev/null +++ b/metadata/org.droidtr.deletegapps/en-US/summary.txt @@ -0,0 +1 @@ +Delete/disable GApps diff --git a/metadata/org.droidtr.keyboard.yml b/metadata/org.droidtr.keyboard.yml index 68310b9fd3..8532c7fe1a 100644 --- a/metadata/org.droidtr.keyboard.yml +++ b/metadata/org.droidtr.keyboard.yml @@ -6,7 +6,6 @@ SourceCode: https://gitlab.com/droidtr/org.droidtr.keyboard IssueTracker: https://gitlab.com/droidtr/org.droidtr.keyboard/issues AutoName: DroidTR keyboard -Summary: DroidTR IME (Turkish F/Q keyboard) Description: |- Features: * Small size diff --git a/metadata/org.droidtr.keyboard/en-US/summary.txt b/metadata/org.droidtr.keyboard/en-US/summary.txt new file mode 100644 index 0000000000..69edba8a0e --- /dev/null +++ b/metadata/org.droidtr.keyboard/en-US/summary.txt @@ -0,0 +1 @@ +DroidTR IME (Turkish F/Q keyboard) diff --git a/metadata/org.dystopia.email.yml b/metadata/org.dystopia.email.yml index 2c9ea3b16a..4a929fa66b 100644 --- a/metadata/org.dystopia.email.yml +++ b/metadata/org.dystopia.email.yml @@ -9,7 +9,6 @@ Changelog: https://framagit.org/dystopia-project/simple-email/blob/HEAD/CHANGELO Name: SimpleEmail AutoName: Email -Summary: Simple and minimalistic email app Description: |- SimpleEmail is Free Software, minimalistic and privacy friendly email app. diff --git a/metadata/org.dystopia.email/en-US/summary.txt b/metadata/org.dystopia.email/en-US/summary.txt new file mode 100644 index 0000000000..ffee2900d5 --- /dev/null +++ b/metadata/org.dystopia.email/en-US/summary.txt @@ -0,0 +1 @@ +Simple and minimalistic email app diff --git a/metadata/org.elijaxapps.androidxmrigminer.yml b/metadata/org.elijaxapps.androidxmrigminer.yml index eadb580319..35d622a005 100644 --- a/metadata/org.elijaxapps.androidxmrigminer.yml +++ b/metadata/org.elijaxapps.androidxmrigminer.yml @@ -9,7 +9,6 @@ Bitcoin: 37GpugVZNiof2DzWQX5aivHewc4wZLxATL Name: Android XMRig Miner AutoName: AndroidMiner -Summary: Mine cryptocoins with XMRig miner on your smartphone Description: |- This is a direct port of XMRIG Miner to an APP. With this, you can mine different crypto coins based on the cryptonight diff --git a/metadata/org.elijaxapps.androidxmrigminer/en-US/summary.txt b/metadata/org.elijaxapps.androidxmrigminer/en-US/summary.txt new file mode 100644 index 0000000000..fe399fa830 --- /dev/null +++ b/metadata/org.elijaxapps.androidxmrigminer/en-US/summary.txt @@ -0,0 +1 @@ +Mine cryptocoins with XMRig miner on your smartphone diff --git a/metadata/org.example.rosary.yml b/metadata/org.example.rosary.yml index f2124f6c36..a8ab1ebe39 100644 --- a/metadata/org.example.rosary.yml +++ b/metadata/org.example.rosary.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/jfcolom/rosary IssueTracker: https://github.com/jfcolom/rosary/issues AutoName: Rosary -Summary: Help for praying the christian Holy Rosary (Spanish) Description: This is a very simple app helping christian users to pray the Rosary. It basically shows biblical texts for the mysteries in an ordered way, and simulate beads to count Hail Mary prayers. Currently, it only supports Spanish language diff --git a/metadata/org.example.rosary/en-US/summary.txt b/metadata/org.example.rosary/en-US/summary.txt new file mode 100644 index 0000000000..c4ec5d7dae --- /dev/null +++ b/metadata/org.example.rosary/en-US/summary.txt @@ -0,0 +1 @@ +Help for praying the christian Holy Rosary (Spanish) diff --git a/metadata/org.flyve.mdm.agent.mqtt.yml b/metadata/org.flyve.mdm.agent.mqtt.yml index c1e280c4c0..7fda5ab388 100644 --- a/metadata/org.flyve.mdm.agent.mqtt.yml +++ b/metadata/org.flyve.mdm.agent.mqtt.yml @@ -9,7 +9,6 @@ IssueTracker: https://github.com/flyve-mdm/android-mdm-agent/issues/ Changelog: https://github.com/flyve-mdm/android-mdm-agent/raw/HEAD/CHANGELOG.md AutoName: Flyve MDM Agent -Summary: Manage and secure effectively your mobile devices and applications Description: |- Flyve MDM is an award winning mobile device management software that enables organizations manage their entire mobile fleet with ease. Give your IT security diff --git a/metadata/org.flyve.mdm.agent.mqtt/en-US/summary.txt b/metadata/org.flyve.mdm.agent.mqtt/en-US/summary.txt new file mode 100644 index 0000000000..0f512d8d47 --- /dev/null +++ b/metadata/org.flyve.mdm.agent.mqtt/en-US/summary.txt @@ -0,0 +1 @@ +Manage and secure effectively your mobile devices and applications diff --git a/metadata/org.handmadeideas.chordreader.yml b/metadata/org.handmadeideas.chordreader.yml index b669b9683a..2c55970c04 100644 --- a/metadata/org.handmadeideas.chordreader.yml +++ b/metadata/org.handmadeideas.chordreader.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/marcelklehr/chordreader IssueTracker: https://github.com/marcelklehr/chordreader/issues AutoName: Chord Reader -Summary: Search for, display, transpose and save chords on your phone Description: This simple app allows you to search the web for tabs and chords and capture them for display in the app with the ability to store the chords for offline usage and transpose them to fit your voice. diff --git a/metadata/org.handmadeideas.chordreader/en-US/summary.txt b/metadata/org.handmadeideas.chordreader/en-US/summary.txt new file mode 100644 index 0000000000..9e2999e5e7 --- /dev/null +++ b/metadata/org.handmadeideas.chordreader/en-US/summary.txt @@ -0,0 +1 @@ +Search for, display, transpose and save chords on your phone diff --git a/metadata/org.jschwab.openrecipes.yml b/metadata/org.jschwab.openrecipes.yml index 5563ef2ba2..52be58a9e8 100644 --- a/metadata/org.jschwab.openrecipes.yml +++ b/metadata/org.jschwab.openrecipes.yml @@ -9,7 +9,6 @@ IssueTracker: https://gitlab.com/ddorian/openrecipes/issues Changelog: https://gitlab.com/ddorian/openrecipes/tags AutoName: OpenRecipes -Summary: A privacy friendly personal cook book Description: |- A privacy friendly personal cook book with synchronization features. Manage your favorite recipes, use the end-to-end encrypted synchronization to diff --git a/metadata/org.jschwab.openrecipes/en-US/summary.txt b/metadata/org.jschwab.openrecipes/en-US/summary.txt new file mode 100644 index 0000000000..6eb53613f7 --- /dev/null +++ b/metadata/org.jschwab.openrecipes/en-US/summary.txt @@ -0,0 +1 @@ +A privacy friendly personal cook book diff --git a/metadata/org.jwz.xscreensaver.yml b/metadata/org.jwz.xscreensaver.yml index c9845a57d3..b63f2bed18 100644 --- a/metadata/org.jwz.xscreensaver.yml +++ b/metadata/org.jwz.xscreensaver.yml @@ -7,7 +7,6 @@ WebSite: https://www.jwz.org/xscreensaver/ SourceCode: https://github.com/Zygo/xscreensaver Changelog: https://www.jwz.org/xscreensaver/changelog.html -Summary: Standard screen saver collection shipped on most Linux and Unix systems Description: | XScreenSaver has about 150 different live wallpapers (and now daydreams as well) to use on your screen - with more coming in future editions! This is one of the best and most robust live wallpaper apps out there. diff --git a/metadata/org.jwz.xscreensaver/en-US/summary.txt b/metadata/org.jwz.xscreensaver/en-US/summary.txt new file mode 100644 index 0000000000..cc9ed7cc86 --- /dev/null +++ b/metadata/org.jwz.xscreensaver/en-US/summary.txt @@ -0,0 +1 @@ +Standard screen saver collection shipped on most Linux and Unix systems diff --git a/metadata/org.kiwix.kiwixcustomwikivoyageeurope.yml b/metadata/org.kiwix.kiwixcustomwikivoyageeurope.yml index 8a52d6481b..9e2d59fbe7 100644 --- a/metadata/org.kiwix.kiwixcustomwikivoyageeurope.yml +++ b/metadata/org.kiwix.kiwixcustomwikivoyageeurope.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/kiwix/kiwix-android IssueTracker: https://github.com/kiwix/kiwix-android/issues Changelog: https://github.com/kiwix/kiwix-android/blob/HEAD/CHANGELOG -Summary: Offline version of the Wikivoyage Travel Guide Description: |- Wikivoyage is a free travel guide that allows you to browse all the information you need about every destination in Europe without an internet connection: no roaming fees when you are traveling abroad! diff --git a/metadata/org.kiwix.kiwixcustomwikivoyageeurope/en-US/summary.txt b/metadata/org.kiwix.kiwixcustomwikivoyageeurope/en-US/summary.txt new file mode 100644 index 0000000000..873753bb31 --- /dev/null +++ b/metadata/org.kiwix.kiwixcustomwikivoyageeurope/en-US/summary.txt @@ -0,0 +1 @@ +Offline version of the Wikivoyage Travel Guide diff --git a/metadata/org.legtux.m_316k.fortune.yml b/metadata/org.legtux.m_316k.fortune.yml index 5a47220d75..3442c1347b 100644 --- a/metadata/org.legtux.m_316k.fortune.yml +++ b/metadata/org.legtux.m_316k.fortune.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/316k/android-fortune IssueTracker: https://github.com/316k/android-fortune/issues AutoName: Fortunes -Summary: View Unix fortunes Description: |- Simple viewer for [https://en.wikipedia.org/wiki/Fortune_%28Unix%29 Unix fortunes]. diff --git a/metadata/org.legtux.m_316k.fortune/en-US/summary.txt b/metadata/org.legtux.m_316k.fortune/en-US/summary.txt new file mode 100644 index 0000000000..2940416043 --- /dev/null +++ b/metadata/org.legtux.m_316k.fortune/en-US/summary.txt @@ -0,0 +1 @@ +View Unix fortunes diff --git a/metadata/org.legtux.m_316k.taptheblacktiles.yml b/metadata/org.legtux.m_316k.taptheblacktiles.yml index d97d59b688..4cc120236c 100644 --- a/metadata/org.legtux.m_316k.taptheblacktiles.yml +++ b/metadata/org.legtux.m_316k.taptheblacktiles.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/316k/android-tap-the-black-tiles/ IssueTracker: https://github.com/316k/android-tap-the-black-tiles//issues AutoName: Tap the black tiles -Summary: Touch the correct tiles to win Description: Tap the black tiles and avoid the white ones. RepoType: git diff --git a/metadata/org.legtux.m_316k.taptheblacktiles/en-US/summary.txt b/metadata/org.legtux.m_316k.taptheblacktiles/en-US/summary.txt new file mode 100644 index 0000000000..453f2bd386 --- /dev/null +++ b/metadata/org.legtux.m_316k.taptheblacktiles/en-US/summary.txt @@ -0,0 +1 @@ +Touch the correct tiles to win diff --git a/metadata/org.lenchan139.ncbookmark.yml b/metadata/org.lenchan139.ncbookmark.yml index cbe846a45e..b67a094ad6 100644 --- a/metadata/org.lenchan139.ncbookmark.yml +++ b/metadata/org.lenchan139.ncbookmark.yml @@ -5,7 +5,6 @@ SourceCode: https://gitlab.com/lenchan139/NCBookmark IssueTracker: https://gitlab.com/lenchan139/NCBookmark/issues AutoName: NC Bookmark Viewer -Summary: This is a lightweight viewer for Nextcloud bookmarks Description: |- With this application you can view, add and edit bookmarks in your Nextcloud. You need to have the bookmarks app installed. diff --git a/metadata/org.lenchan139.ncbookmark/en-US/summary.txt b/metadata/org.lenchan139.ncbookmark/en-US/summary.txt new file mode 100644 index 0000000000..26b655eb25 --- /dev/null +++ b/metadata/org.lenchan139.ncbookmark/en-US/summary.txt @@ -0,0 +1 @@ +This is a lightweight viewer for Nextcloud bookmarks diff --git a/metadata/org.lf_net.pgpunlocker.yml b/metadata/org.lf_net.pgpunlocker.yml index 91bb3350dc..81fca39bc9 100644 --- a/metadata/org.lf_net.pgpunlocker.yml +++ b/metadata/org.lf_net.pgpunlocker.yml @@ -9,7 +9,6 @@ FlattrID: '372271' Bitcoin: 18ii4wvKxPFvKoGk7MXLngq9yWNsp7ABPd AutoName: PGPAuth -Summary: Send PGP-verified requests Description: |- This app sends GPG-verified requests over the internet to a given server. diff --git a/metadata/org.lf_net.pgpunlocker/en-US/summary.txt b/metadata/org.lf_net.pgpunlocker/en-US/summary.txt new file mode 100644 index 0000000000..f7d52140fb --- /dev/null +++ b/metadata/org.lf_net.pgpunlocker/en-US/summary.txt @@ -0,0 +1 @@ +Send PGP-verified requests diff --git a/metadata/org.liberty.android.fantastischmemo.yml b/metadata/org.liberty.android.fantastischmemo.yml index 1ff249d0be..7b08e6a6a6 100644 --- a/metadata/org.liberty.android.fantastischmemo.yml +++ b/metadata/org.liberty.android.fantastischmemo.yml @@ -8,7 +8,6 @@ Changelog: https://anymemo.org/versions-view Donate: https://anymemo.org AutoName: AnyMemo -Summary: Flashcard-based Learning Description: |- Cards show on the screen with questions and the answers can be revealed or read out by touching the panel below the question. diff --git a/metadata/org.liberty.android.fantastischmemo/en-US/summary.txt b/metadata/org.liberty.android.fantastischmemo/en-US/summary.txt new file mode 100644 index 0000000000..c0e4c8b1e2 --- /dev/null +++ b/metadata/org.liberty.android.fantastischmemo/en-US/summary.txt @@ -0,0 +1 @@ +Flashcard-based Learning diff --git a/metadata/org.liberty.android.freeotpplus.yml b/metadata/org.liberty.android.freeotpplus.yml index 2b7f103679..e495be2405 100644 --- a/metadata/org.liberty.android.freeotpplus.yml +++ b/metadata/org.liberty.android.freeotpplus.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/helloworld1/FreeOTPPlus IssueTracker: https://github.com/helloworld1/FreeOTPPlus/issues AutoName: FreeOTP Plus -Summary: Two-factor authentication with import/export functionality Description: |- FreeOTP Plus is a fork of FreeOTP provided by Red Hat with the following enhancements: diff --git a/metadata/org.liberty.android.freeotpplus/en-US/summary.txt b/metadata/org.liberty.android.freeotpplus/en-US/summary.txt new file mode 100644 index 0000000000..1e5bedc164 --- /dev/null +++ b/metadata/org.liberty.android.freeotpplus/en-US/summary.txt @@ -0,0 +1 @@ +Two-factor authentication with import/export functionality diff --git a/metadata/org.libreflix.app.yml b/metadata/org.libreflix.app.yml index 8d04d3e658..a01ee586f3 100644 --- a/metadata/org.libreflix.app.yml +++ b/metadata/org.libreflix.app.yml @@ -7,7 +7,6 @@ IssueTracker: https://notabug.org/kassiano.resende/LibreflixApp/issues Donate: https://acredito.me/libreflix2018 AutoName: Libreflix -Summary: Stream and watch independent films Description: |- Libreflix is an open and collaborative streaming platform that brings together independent, free-to-air and thought-provoking audiovisual productions. diff --git a/metadata/org.libreflix.app/en-US/summary.txt b/metadata/org.libreflix.app/en-US/summary.txt new file mode 100644 index 0000000000..00f2f841c2 --- /dev/null +++ b/metadata/org.libreflix.app/en-US/summary.txt @@ -0,0 +1 @@ +Stream and watch independent films diff --git a/metadata/org.libreoffice.impressremote.yml b/metadata/org.libreoffice.impressremote.yml index bc31ec3089..309e4ac5e7 100644 --- a/metadata/org.libreoffice.impressremote.yml +++ b/metadata/org.libreoffice.impressremote.yml @@ -9,7 +9,6 @@ FlattrID: '256305' Bitcoin: 129jj3HiLfj3zCfqoro3sMTdovizXEdo8A AutoName: Impress Remote -Summary: Remote for presentations Description: |- Interact with your slideshow presentation from your Android device. diff --git a/metadata/org.libreoffice.impressremote/en-US/summary.txt b/metadata/org.libreoffice.impressremote/en-US/summary.txt new file mode 100644 index 0000000000..1f244a1fa7 --- /dev/null +++ b/metadata/org.libreoffice.impressremote/en-US/summary.txt @@ -0,0 +1 @@ +Remote for presentations diff --git a/metadata/org.ligi.ajsha.yml b/metadata/org.ligi.ajsha.yml index fba7be69d5..45b5929c6c 100644 --- a/metadata/org.ligi.ajsha.yml +++ b/metadata/org.ligi.ajsha.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/ligi/AJShA IssueTracker: https://github.com/ligi/AJShA/issues AutoName: AJShA Android Java Shell App -Summary: Run Java code directly Description: |- With this App you can quickly eval some Android Java code - scripting style for fast iterations, experiments and API exploration. diff --git a/metadata/org.ligi.ajsha/en-US/summary.txt b/metadata/org.ligi.ajsha/en-US/summary.txt new file mode 100644 index 0000000000..09f2f016cf --- /dev/null +++ b/metadata/org.ligi.ajsha/en-US/summary.txt @@ -0,0 +1 @@ +Run Java code directly diff --git a/metadata/org.ligi.blexplorer.yml b/metadata/org.ligi.blexplorer.yml index 70cb892e86..f8644db864 100644 --- a/metadata/org.ligi.blexplorer.yml +++ b/metadata/org.ligi.blexplorer.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/ligi/BLExplorer IssueTracker: https://github.com/ligi/BLExplorer/issues AutoName: BLExplorer -Summary: Bluetooth Low Energy Explorer Description: Exlore Bluetooth Low Energy Devices - see values and UUIDS. RepoType: git diff --git a/metadata/org.ligi.blexplorer/en-US/summary.txt b/metadata/org.ligi.blexplorer/en-US/summary.txt new file mode 100644 index 0000000000..cbf3c91e9d --- /dev/null +++ b/metadata/org.ligi.blexplorer/en-US/summary.txt @@ -0,0 +1 @@ +Bluetooth Low Energy Explorer diff --git a/metadata/org.ligi.etheremote.yml b/metadata/org.ligi.etheremote.yml index cccde45b5a..6f026d738d 100644 --- a/metadata/org.ligi.etheremote.yml +++ b/metadata/org.ligi.etheremote.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/ligi/etheremote IssueTracker: https://github.com/ligi/etheremote/issues AutoName: ΞtheRemotΞ -Summary: Ethereum Remote Description: A Remote to access Ethereum nodes via JSON-RPC. RepoType: git diff --git a/metadata/org.ligi.etheremote/en-US/summary.txt b/metadata/org.ligi.etheremote/en-US/summary.txt new file mode 100644 index 0000000000..18b85144ff --- /dev/null +++ b/metadata/org.ligi.etheremote/en-US/summary.txt @@ -0,0 +1 @@ +Ethereum Remote diff --git a/metadata/org.ligi.fast.yml b/metadata/org.ligi.fast.yml index ed3e014335..a6d902a919 100644 --- a/metadata/org.ligi.fast.yml +++ b/metadata/org.ligi.fast.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/ligi/FAST IssueTracker: https://github.com/ligi/FAST/issues AutoName: FAST App Search Tool -Summary: Find apps just by typing Description: |- Find your apps without needing to scroll through lists. It can display icons or not and search for package names too if the option is selected. Long-pressing an diff --git a/metadata/org.ligi.fast/en-US/summary.txt b/metadata/org.ligi.fast/en-US/summary.txt new file mode 100644 index 0000000000..3917e7c046 --- /dev/null +++ b/metadata/org.ligi.fast/en-US/summary.txt @@ -0,0 +1 @@ +Find apps just by typing diff --git a/metadata/org.ligi.faster.yml b/metadata/org.ligi.faster.yml index 2dc2515520..62c5571f31 100644 --- a/metadata/org.ligi.faster.yml +++ b/metadata/org.ligi.faster.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/ligi/FAST/issues Name: FASTer App Search Tool AutoName: FAST App Search Tool -Summary: Find apps just by typing Description: |- Find your apps without needing to scroll through lists. It can display icons or not and search for package names too if the option is selected. Long-pressing an diff --git a/metadata/org.ligi.faster/en-US/summary.txt b/metadata/org.ligi.faster/en-US/summary.txt new file mode 100644 index 0000000000..3917e7c046 --- /dev/null +++ b/metadata/org.ligi.faster/en-US/summary.txt @@ -0,0 +1 @@ +Find apps just by typing diff --git a/metadata/org.ligi.gobandroid_hd.yml b/metadata/org.ligi.gobandroid_hd.yml index 5cd014ba29..3dcf9c9d8b 100644 --- a/metadata/org.ligi.gobandroid_hd.yml +++ b/metadata/org.ligi.gobandroid_hd.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/ligi/gobandroid IssueTracker: https://github.com/ligi/gobandroid/issues AutoName: Gobandroid -Summary: Ancient Go game Description: |- Gobandroid is virtual goban (GO-Board) on your mobile to study and play the ancient game of Go (weiqi in Chinese, igo in Japanese, baduk in Korean). diff --git a/metadata/org.ligi.gobandroid_hd/en-US/summary.txt b/metadata/org.ligi.gobandroid_hd/en-US/summary.txt new file mode 100644 index 0000000000..8ca924f1f8 --- /dev/null +++ b/metadata/org.ligi.gobandroid_hd/en-US/summary.txt @@ -0,0 +1 @@ +Ancient Go game diff --git a/metadata/org.ligi.ipfsdroid.yml b/metadata/org.ligi.ipfsdroid.yml index 126cd66d2e..d03146d9aa 100644 --- a/metadata/org.ligi.ipfsdroid.yml +++ b/metadata/org.ligi.ipfsdroid.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/ligi/IPFSDroid IssueTracker: https://github.com/ligi/IPFSDroid/issues AutoName: IPFSDroid -Summary: IPFS Tool Description: |- Client for the [https://en.wikipedia.org/wiki/InterPlanetary_File_System InterPlanetary File System] (IPFS). diff --git a/metadata/org.ligi.ipfsdroid/en-US/summary.txt b/metadata/org.ligi.ipfsdroid/en-US/summary.txt new file mode 100644 index 0000000000..2332438e6f --- /dev/null +++ b/metadata/org.ligi.ipfsdroid/en-US/summary.txt @@ -0,0 +1 @@ +IPFS Tool diff --git a/metadata/org.ligi.materialteatimer.yml b/metadata/org.ligi.materialteatimer.yml index d67703768f..209497c122 100644 --- a/metadata/org.ligi.materialteatimer.yml +++ b/metadata/org.ligi.materialteatimer.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/ligi/MaterialTeaTimer IssueTracker: https://github.com/ligi/MaterialTeaTimer/issues AutoName: Material Tea Timer -Summary: Time your tea with style Description: |- Material design themed tea timer. Time your tea with material style. Shows you temperature and time quickly. Have a great tea! diff --git a/metadata/org.ligi.materialteatimer/en-US/summary.txt b/metadata/org.ligi.materialteatimer/en-US/summary.txt new file mode 100644 index 0000000000..e3bc42c548 --- /dev/null +++ b/metadata/org.ligi.materialteatimer/en-US/summary.txt @@ -0,0 +1 @@ +Time your tea with style diff --git a/metadata/org.ligi.passandroid.yml b/metadata/org.ligi.passandroid.yml index 722134b9fb..8ba364b224 100644 --- a/metadata/org.ligi.passandroid.yml +++ b/metadata/org.ligi.passandroid.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/ligi/PassAndroid IssueTracker: https://github.com/ligi/PassAndroid/issues AutoName: PassAndroid -Summary: View Passbook files Description: |- Displays Passbook (*.pkpass) files & shows the Barcode (QR, PDF417 and AZTEC format). It can be used also when offline. diff --git a/metadata/org.ligi.passandroid/en-US/summary.txt b/metadata/org.ligi.passandroid/en-US/summary.txt new file mode 100644 index 0000000000..a7fbd8de5c --- /dev/null +++ b/metadata/org.ligi.passandroid/en-US/summary.txt @@ -0,0 +1 @@ +View Passbook files diff --git a/metadata/org.ligi.satoshiproof.yml b/metadata/org.ligi.satoshiproof.yml index e4cb15212e..2057e4f027 100644 --- a/metadata/org.ligi.satoshiproof.yml +++ b/metadata/org.ligi.satoshiproof.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/ligi/SatoshiProof IssueTracker: https://github.com/ligi/SatoshiProof/issues AutoName: Satoshi Proof -Summary: Prove chronology of events Description: |- Use the Bitcoin network like a notary. For example if your bike is damaged you can take a photo; then the app sends a small amount of bitcoins (a Satoshi) to a diff --git a/metadata/org.ligi.satoshiproof/en-US/summary.txt b/metadata/org.ligi.satoshiproof/en-US/summary.txt new file mode 100644 index 0000000000..3fd7d1b2af --- /dev/null +++ b/metadata/org.ligi.satoshiproof/en-US/summary.txt @@ -0,0 +1 @@ +Prove chronology of events diff --git a/metadata/org.ligi.scr.yml b/metadata/org.ligi.scr.yml index b7f70b3275..37252180e9 100644 --- a/metadata/org.ligi.scr.yml +++ b/metadata/org.ligi.scr.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/ligi/SCR IssueTracker: https://github.com/ligi/SCR/issues AutoName: 33c3 SCR -Summary: Resolve Schedule conflicts Description: Mark the talks you want to see at 33C3 and prevent schedule conflicts this way. diff --git a/metadata/org.ligi.scr/en-US/summary.txt b/metadata/org.ligi.scr/en-US/summary.txt new file mode 100644 index 0000000000..d18f0ffc08 --- /dev/null +++ b/metadata/org.ligi.scr/en-US/summary.txt @@ -0,0 +1 @@ +Resolve Schedule conflicts diff --git a/metadata/org.ligi.survivalmanual.yml b/metadata/org.ligi.survivalmanual.yml index 92e2d110cd..fb3a5a6e52 100644 --- a/metadata/org.ligi.survivalmanual.yml +++ b/metadata/org.ligi.survivalmanual.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/ligi/SurvivalManual IssueTracker: https://github.com/ligi/SurvivalManual/issues AutoName: Survival Manual -Summary: Learn how to survive Description: |- Survival Manual based on the Army Field Manual 21-76 - fully working offline. It contains info on how to make fire, build a shelter, find food, heal and other diff --git a/metadata/org.ligi.survivalmanual/en-US/summary.txt b/metadata/org.ligi.survivalmanual/en-US/summary.txt new file mode 100644 index 0000000000..96a17a1371 --- /dev/null +++ b/metadata/org.ligi.survivalmanual/en-US/summary.txt @@ -0,0 +1 @@ +Learn how to survive diff --git a/metadata/org.ligi.vaporizercontrol.yml b/metadata/org.ligi.vaporizercontrol.yml index f3659e8730..5e57c21c6c 100644 --- a/metadata/org.ligi.vaporizercontrol.yml +++ b/metadata/org.ligi.vaporizercontrol.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/ligi/VaporizerControl IssueTracker: https://github.com/ligi/VaporizerControl/issues AutoName: Vaporizer Control Crafty -Summary: Control vaporizers via BLE Description: Control your vaporizer ( currently only crafty ) with this app. RepoType: git diff --git a/metadata/org.ligi.vaporizercontrol/en-US/summary.txt b/metadata/org.ligi.vaporizercontrol/en-US/summary.txt new file mode 100644 index 0000000000..7d080c8a41 --- /dev/null +++ b/metadata/org.ligi.vaporizercontrol/en-US/summary.txt @@ -0,0 +1 @@ +Control vaporizers via BLE diff --git a/metadata/org.linphone.yml b/metadata/org.linphone.yml index fa68ce39fd..b574814852 100644 --- a/metadata/org.linphone.yml +++ b/metadata/org.linphone.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/BelledonneCommunications/linphone-android/issue Changelog: https://github.com/BelledonneCommunications/linphone-android/blob/HEAD/CHANGELOG.md#change-log AutoName: Linphone -Summary: SIP (VOIP) phone Description: |- * Audio: speex; Opus; iLBC; G711; GSM; G722; Silk; PCMA; PCMU; AMR-WB; AAC-ELD * Video with VP8, mpeg4, x264; H263 diff --git a/metadata/org.linphone/en-US/summary.txt b/metadata/org.linphone/en-US/summary.txt new file mode 100644 index 0000000000..357dacbc20 --- /dev/null +++ b/metadata/org.linphone/en-US/summary.txt @@ -0,0 +1 @@ +SIP (VOIP) phone diff --git a/metadata/org.logicallycreative.movingpolygons.yml b/metadata/org.logicallycreative.movingpolygons.yml index c98a8b62b5..0863ccdcbe 100644 --- a/metadata/org.logicallycreative.movingpolygons.yml +++ b/metadata/org.logicallycreative.movingpolygons.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/jagossel/MovingPolygons/issues Changelog: https://github.com/jagossel/MovingPolygons/releases AutoName: Moving Polygons -Summary: Bouncing lines live wallpaper Description: |- Simple live wallpaper with a series of lines that have points bouncing off of the screen. diff --git a/metadata/org.logicallycreative.movingpolygons/en-US/summary.txt b/metadata/org.logicallycreative.movingpolygons/en-US/summary.txt new file mode 100644 index 0000000000..c139845c33 --- /dev/null +++ b/metadata/org.logicallycreative.movingpolygons/en-US/summary.txt @@ -0,0 +1 @@ +Bouncing lines live wallpaper diff --git a/metadata/org.lufebe16.pysolfc.yml b/metadata/org.lufebe16.pysolfc.yml index 5b64b8d939..7372e73f77 100644 --- a/metadata/org.lufebe16.pysolfc.yml +++ b/metadata/org.lufebe16.pysolfc.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/shlomif/PySolFC IssueTracker: https://github.com/shlomif/PySolFC/issues Changelog: https://pysolfc.sourceforge.io/#news -Summary: A collection of solitaire card games Description: |- PySolFC is a collection of solitaire games written in Python. diff --git a/metadata/org.lufebe16.pysolfc/en-US/summary.txt b/metadata/org.lufebe16.pysolfc/en-US/summary.txt new file mode 100644 index 0000000000..f45431e0fc --- /dev/null +++ b/metadata/org.lufebe16.pysolfc/en-US/summary.txt @@ -0,0 +1 @@ +A collection of solitaire card games diff --git a/metadata/org.lumicall.android.yml b/metadata/org.lumicall.android.yml index 2c2534dbdb..4f174ff026 100644 --- a/metadata/org.lumicall.android.yml +++ b/metadata/org.lumicall.android.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/opentelecoms-org/lumicall IssueTracker: https://github.com/opentelecoms-org/lumicall/issues AutoName: Lumicall -Summary: SIP softphone Description: |- SIP softphone with a comprehensive range of features: diff --git a/metadata/org.lumicall.android/en-US/summary.txt b/metadata/org.lumicall.android/en-US/summary.txt new file mode 100644 index 0000000000..2fcb799421 --- /dev/null +++ b/metadata/org.lumicall.android/en-US/summary.txt @@ -0,0 +1 @@ +SIP softphone diff --git a/metadata/org.mcxa.softsound.yml b/metadata/org.mcxa.softsound.yml index 2149a7637e..cd3af065d2 100644 --- a/metadata/org.mcxa.softsound.yml +++ b/metadata/org.mcxa.softsound.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/ianmcxa/Soft-Sound IssueTracker: https://github.com/ianmcxa/Soft-Sound/issues AutoName: Soft Sound -Summary: Play relaxing sounds Description: |- Play relaxing sounds to help you sleep, concentrate or stay calm. The sound files used are from soundbible.com and are licensed under Creative Commons diff --git a/metadata/org.mcxa.softsound/en-US/summary.txt b/metadata/org.mcxa.softsound/en-US/summary.txt new file mode 100644 index 0000000000..7f0271bd0c --- /dev/null +++ b/metadata/org.mcxa.softsound/en-US/summary.txt @@ -0,0 +1 @@ +Play relaxing sounds diff --git a/metadata/org.mozc.android.inputmethod.japanese.yml b/metadata/org.mozc.android.inputmethod.japanese.yml index a64b4e3c8f..a16beb0c33 100644 --- a/metadata/org.mozc.android.inputmethod.japanese.yml +++ b/metadata/org.mozc.android.inputmethod.japanese.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/google/mozc IssueTracker: https://github.com/google/mozc/issues Changelog: https://github.com/google/mozc/blob/HEAD/docs/release_history.md -Summary: Japanese Input Method Editor Description: Mozc is a Japanese Input Method Editor (IME). RepoType: git diff --git a/metadata/org.mozc.android.inputmethod.japanese/en-US/summary.txt b/metadata/org.mozc.android.inputmethod.japanese/en-US/summary.txt new file mode 100644 index 0000000000..d80ba4f425 --- /dev/null +++ b/metadata/org.mozc.android.inputmethod.japanese/en-US/summary.txt @@ -0,0 +1 @@ +Japanese Input Method Editor diff --git a/metadata/org.mupen64plusae.v3.alpha.yml b/metadata/org.mupen64plusae.v3.alpha.yml index 387d181c29..7b21ddaef1 100644 --- a/metadata/org.mupen64plusae.v3.alpha.yml +++ b/metadata/org.mupen64plusae.v3.alpha.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/mupen64plus-ae/mupen64plus-ae/issues Name: Mupen64Plus AE AutoName: Mupen64Plus -Summary: Front end for Mupen64 Plus Description: Mupen64Plus, Android Edition (AE) is an Android user interface for the Mupen64Plus Nintendo 64 emulator. diff --git a/metadata/org.mupen64plusae.v3.alpha/en-US/summary.txt b/metadata/org.mupen64plusae.v3.alpha/en-US/summary.txt new file mode 100644 index 0000000000..4d9abb8edb --- /dev/null +++ b/metadata/org.mupen64plusae.v3.alpha/en-US/summary.txt @@ -0,0 +1 @@ +Front end for Mupen64 Plus diff --git a/metadata/org.nitri.opentopo.yml b/metadata/org.nitri.opentopo.yml index 29a718c795..a10cdca078 100755 --- a/metadata/org.nitri.opentopo.yml +++ b/metadata/org.nitri.opentopo.yml @@ -8,7 +8,6 @@ Donate: https://ko-fi.com/U7U372JJ Name: OpenTopoMap Viewer AutoName: OpenTopoMap -Summary: OpenTopoMap viewer with GPX import Description: |- An online OpenTopoMap client with caching. diff --git a/metadata/org.nitri.opentopo/en-US/summary.txt b/metadata/org.nitri.opentopo/en-US/summary.txt new file mode 100644 index 0000000000..f8eb46eecf --- /dev/null +++ b/metadata/org.nitri.opentopo/en-US/summary.txt @@ -0,0 +1 @@ +OpenTopoMap viewer with GPX import diff --git a/metadata/org.openobservatory.ooniprobe.yml b/metadata/org.openobservatory.ooniprobe.yml index 2697677586..b59684eeab 100644 --- a/metadata/org.openobservatory.ooniprobe.yml +++ b/metadata/org.openobservatory.ooniprobe.yml @@ -9,7 +9,6 @@ Translation: https://www.transifex.com/otf/ooniprobe/ Changelog: https://github.com/ooni/probe-android/releases AutoName: OONI Probe -Summary: Open Observatory of Network Interference (OONI) Description: |- Are websites and social media apps blocked? Is your network unusually slow? Run OONI Probe to find out! diff --git a/metadata/org.openobservatory.ooniprobe/en-US/summary.txt b/metadata/org.openobservatory.ooniprobe/en-US/summary.txt new file mode 100644 index 0000000000..d296610e42 --- /dev/null +++ b/metadata/org.openobservatory.ooniprobe/en-US/summary.txt @@ -0,0 +1 @@ +Open Observatory of Network Interference (OONI) diff --git a/metadata/org.ostrya.presencepublisher.yml b/metadata/org.ostrya.presencepublisher.yml index 89246f0ddb..278794fbdc 100644 --- a/metadata/org.ostrya.presencepublisher.yml +++ b/metadata/org.ostrya.presencepublisher.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/ostrya/PresencePublisher/issues Changelog: https://github.com/ostrya/PresencePublisher/releases AutoName: Presence Publisher -Summary: Regularly publish to an MQTT topic Description: |- This app regularly publishes to a configurable MQTT topic whenever connected to a given WiFi network. It can be used to integrate the presence diff --git a/metadata/org.ostrya.presencepublisher/en-US/summary.txt b/metadata/org.ostrya.presencepublisher/en-US/summary.txt new file mode 100644 index 0000000000..b23e73d375 --- /dev/null +++ b/metadata/org.ostrya.presencepublisher/en-US/summary.txt @@ -0,0 +1 @@ +Regularly publish to an MQTT topic diff --git a/metadata/org.pipoypipagames.towerjumper.yml b/metadata/org.pipoypipagames.towerjumper.yml index 99bd8112b3..1fef23bf8d 100644 --- a/metadata/org.pipoypipagames.towerjumper.yml +++ b/metadata/org.pipoypipagames.towerjumper.yml @@ -8,7 +8,6 @@ IssueTracker: https://github.com/Dariasteam/TowerJumper/issues Changelog: https://github.com/Dariasteam/TowerJumper/releases AutoName: TowerJumper -Summary: Casual ability game Description: | This is a clone of a popular android game in which you move a jumping ball and try to reach the end of a tower avoiding the obstacles. The levels are randomly diff --git a/metadata/org.pipoypipagames.towerjumper/en-US/summary.txt b/metadata/org.pipoypipagames.towerjumper/en-US/summary.txt new file mode 100644 index 0000000000..7b8d7d4f40 --- /dev/null +++ b/metadata/org.pipoypipagames.towerjumper/en-US/summary.txt @@ -0,0 +1 @@ +Casual ability game diff --git a/metadata/org.projectmaxs.main.yml b/metadata/org.projectmaxs.main.yml index 8abf0bef7a..b1fc3c4f9f 100644 --- a/metadata/org.projectmaxs.main.yml +++ b/metadata/org.projectmaxs.main.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Main -Summary: Main component of MAXS Description: |- MAXS (Modular Android XMPP Service) allows you to receive notifications and remote control your Android device over XMPP. You will need at least one diff --git a/metadata/org.projectmaxs.main/en-US/summary.txt b/metadata/org.projectmaxs.main/en-US/summary.txt new file mode 100644 index 0000000000..3d1045f4c8 --- /dev/null +++ b/metadata/org.projectmaxs.main/en-US/summary.txt @@ -0,0 +1 @@ +Main component of MAXS diff --git a/metadata/org.projectmaxs.module.alarmset.yml b/metadata/org.projectmaxs.module.alarmset.yml index 79b402ba2d..6e02020aa4 100644 --- a/metadata/org.projectmaxs.module.alarmset.yml +++ b/metadata/org.projectmaxs.module.alarmset.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module AlarmSet -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need "MAXS Main" and a configured MAXS Transport to make use of it. diff --git a/metadata/org.projectmaxs.module.alarmset/en-US/summary.txt b/metadata/org.projectmaxs.module.alarmset/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.alarmset/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.module.bluetooth.yml b/metadata/org.projectmaxs.module.bluetooth.yml index d02001eaf1..9fa9c46bfb 100644 --- a/metadata/org.projectmaxs.module.bluetooth.yml +++ b/metadata/org.projectmaxs.module.bluetooth.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module Bluetooth -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need "MAXS Main" and a configured MAXS Transport to make use of it. diff --git a/metadata/org.projectmaxs.module.bluetooth/en-US/summary.txt b/metadata/org.projectmaxs.module.bluetooth/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.bluetooth/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.module.bluetoothadmin.yml b/metadata/org.projectmaxs.module.bluetoothadmin.yml index e3126acdff..fa0f099946 100644 --- a/metadata/org.projectmaxs.module.bluetoothadmin.yml +++ b/metadata/org.projectmaxs.module.bluetoothadmin.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module BluetoothAdmin -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need "MAXS Main" and a configured MAXS Transport to make use of it. diff --git a/metadata/org.projectmaxs.module.bluetoothadmin/en-US/summary.txt b/metadata/org.projectmaxs.module.bluetoothadmin/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.bluetoothadmin/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.module.clipboard.yml b/metadata/org.projectmaxs.module.clipboard.yml index e3c27f189b..86e3761119 100644 --- a/metadata/org.projectmaxs.module.clipboard.yml +++ b/metadata/org.projectmaxs.module.clipboard.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module Clipboard -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need "MAXS Main" and a configured MAXS Transport to make use of it. diff --git a/metadata/org.projectmaxs.module.clipboard/en-US/summary.txt b/metadata/org.projectmaxs.module.clipboard/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.clipboard/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.module.contactsread.yml b/metadata/org.projectmaxs.module.contactsread.yml index f04644267d..a9da17989e 100644 --- a/metadata/org.projectmaxs.module.contactsread.yml +++ b/metadata/org.projectmaxs.module.contactsread.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module ContactsRead -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need [[org.projectmaxs.main]] and a configured MAXS Transport (e.g., diff --git a/metadata/org.projectmaxs.module.contactsread/en-US/summary.txt b/metadata/org.projectmaxs.module.contactsread/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.contactsread/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.module.fileread.yml b/metadata/org.projectmaxs.module.fileread.yml index 332e9d091f..f25d4cac6b 100644 --- a/metadata/org.projectmaxs.module.fileread.yml +++ b/metadata/org.projectmaxs.module.fileread.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module FileRead -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need "MAXS Main" and a configured MAXS Transport to make use of it. diff --git a/metadata/org.projectmaxs.module.fileread/en-US/summary.txt b/metadata/org.projectmaxs.module.fileread/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.fileread/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.module.filewrite.yml b/metadata/org.projectmaxs.module.filewrite.yml index e65bda7b1b..b5707f14bc 100644 --- a/metadata/org.projectmaxs.module.filewrite.yml +++ b/metadata/org.projectmaxs.module.filewrite.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module FileWrite -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need "MAXS Main" and a configured MAXS Transport to make use of it. diff --git a/metadata/org.projectmaxs.module.filewrite/en-US/summary.txt b/metadata/org.projectmaxs.module.filewrite/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.filewrite/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.module.locationfine.yml b/metadata/org.projectmaxs.module.locationfine.yml index 1b5dc4a9ad..e7607fc90e 100644 --- a/metadata/org.projectmaxs.module.locationfine.yml +++ b/metadata/org.projectmaxs.module.locationfine.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module LocationFine -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need "MAXS Main" and a configured MAXS Transport to make use of it. diff --git a/metadata/org.projectmaxs.module.locationfine/en-US/summary.txt b/metadata/org.projectmaxs.module.locationfine/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.locationfine/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.module.misc.yml b/metadata/org.projectmaxs.module.misc.yml index 41893bcd99..e93c91f887 100644 --- a/metadata/org.projectmaxs.module.misc.yml +++ b/metadata/org.projectmaxs.module.misc.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module Misc -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need "MAXS Main" and a configured MAXS Transport to make use of it. diff --git a/metadata/org.projectmaxs.module.misc/en-US/summary.txt b/metadata/org.projectmaxs.module.misc/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.misc/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.module.nfc.yml b/metadata/org.projectmaxs.module.nfc.yml index dc55b9ce88..dcbb533144 100644 --- a/metadata/org.projectmaxs.module.nfc.yml +++ b/metadata/org.projectmaxs.module.nfc.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module NFC -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need "MAXS Main" and a configured MAXS Transport to make use of it. diff --git a/metadata/org.projectmaxs.module.nfc/en-US/summary.txt b/metadata/org.projectmaxs.module.nfc/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.nfc/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.module.notification.yml b/metadata/org.projectmaxs.module.notification.yml index e4143b4ec6..4e69643bcc 100644 --- a/metadata/org.projectmaxs.module.notification.yml +++ b/metadata/org.projectmaxs.module.notification.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module Notification -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need "MAXS Main" and a configured MAXS Transport to make use of it. diff --git a/metadata/org.projectmaxs.module.notification/en-US/summary.txt b/metadata/org.projectmaxs.module.notification/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.notification/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.module.phonestateread.yml b/metadata/org.projectmaxs.module.phonestateread.yml index a2818500c3..0092e1b759 100644 --- a/metadata/org.projectmaxs.module.phonestateread.yml +++ b/metadata/org.projectmaxs.module.phonestateread.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module PhonestateRead -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need "MAXS Main" and a configured MAXS Transport to make use of it. diff --git a/metadata/org.projectmaxs.module.phonestateread/en-US/summary.txt b/metadata/org.projectmaxs.module.phonestateread/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.phonestateread/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.module.ringermode.yml b/metadata/org.projectmaxs.module.ringermode.yml index 66350f7508..13413d971a 100644 --- a/metadata/org.projectmaxs.module.ringermode.yml +++ b/metadata/org.projectmaxs.module.ringermode.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module Ringermode -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need "MAXS Main" and a configured MAXS Transport to make use of it. diff --git a/metadata/org.projectmaxs.module.ringermode/en-US/summary.txt b/metadata/org.projectmaxs.module.ringermode/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.ringermode/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.module.shell.yml b/metadata/org.projectmaxs.module.shell.yml index 36a491c495..7ec69b74af 100644 --- a/metadata/org.projectmaxs.module.shell.yml +++ b/metadata/org.projectmaxs.module.shell.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module Shell -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need "MAXS Main" and a configured MAXS Transport to make use of it. diff --git a/metadata/org.projectmaxs.module.shell/en-US/summary.txt b/metadata/org.projectmaxs.module.shell/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.shell/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.module.smsnotify.yml b/metadata/org.projectmaxs.module.smsnotify.yml index e4e1383a27..50e8c64492 100644 --- a/metadata/org.projectmaxs.module.smsnotify.yml +++ b/metadata/org.projectmaxs.module.smsnotify.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module SmsNotify -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need "MAXS Main" and a configured MAXS Transport to make use of it. diff --git a/metadata/org.projectmaxs.module.smsnotify/en-US/summary.txt b/metadata/org.projectmaxs.module.smsnotify/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.smsnotify/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.module.smsread.yml b/metadata/org.projectmaxs.module.smsread.yml index 61e0680669..c487bf5530 100644 --- a/metadata/org.projectmaxs.module.smsread.yml +++ b/metadata/org.projectmaxs.module.smsread.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module SmsRead -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need "MAXS Main" and a configured MAXS Transport to make use of it. diff --git a/metadata/org.projectmaxs.module.smsread/en-US/summary.txt b/metadata/org.projectmaxs.module.smsread/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.smsread/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.module.smssend.yml b/metadata/org.projectmaxs.module.smssend.yml index 9a0d8145d2..5355ab6f70 100644 --- a/metadata/org.projectmaxs.module.smssend.yml +++ b/metadata/org.projectmaxs.module.smssend.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module SmsSend -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need "MAXS Main" and a configured MAXS Transport to make use of it. diff --git a/metadata/org.projectmaxs.module.smssend/en-US/summary.txt b/metadata/org.projectmaxs.module.smssend/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.smssend/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.module.smswrite.yml b/metadata/org.projectmaxs.module.smswrite.yml index a3cbfc86cd..1d854bf956 100644 --- a/metadata/org.projectmaxs.module.smswrite.yml +++ b/metadata/org.projectmaxs.module.smswrite.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module SmsWrite -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need "MAXS Main" and a configured MAXS Transport to make use of it. diff --git a/metadata/org.projectmaxs.module.smswrite/en-US/summary.txt b/metadata/org.projectmaxs.module.smswrite/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.smswrite/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.module.wifiaccess.yml b/metadata/org.projectmaxs.module.wifiaccess.yml index cd733a4a2b..e33e4c88f8 100644 --- a/metadata/org.projectmaxs.module.wifiaccess.yml +++ b/metadata/org.projectmaxs.module.wifiaccess.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module WifiAccess -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need "MAXS Main" and a configured MAXS Transport to make use of it. diff --git a/metadata/org.projectmaxs.module.wifiaccess/en-US/summary.txt b/metadata/org.projectmaxs.module.wifiaccess/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.wifiaccess/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.module.wifichange.yml b/metadata/org.projectmaxs.module.wifichange.yml index 3379b13eef..d54cfacb85 100644 --- a/metadata/org.projectmaxs.module.wifichange.yml +++ b/metadata/org.projectmaxs.module.wifichange.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Module WifiChange -Summary: A Module for MAXS Description: |- This is a Module for MAXS, which does not install any launcher. You need "MAXS Main" and a configured MAXS Transport to make use of it. diff --git a/metadata/org.projectmaxs.module.wifichange/en-US/summary.txt b/metadata/org.projectmaxs.module.wifichange/en-US/summary.txt new file mode 100644 index 0000000000..8ada62f30e --- /dev/null +++ b/metadata/org.projectmaxs.module.wifichange/en-US/summary.txt @@ -0,0 +1 @@ +A Module for MAXS diff --git a/metadata/org.projectmaxs.transport.xmpp.yml b/metadata/org.projectmaxs.transport.xmpp.yml index 870a53beae..2ed9a7bab4 100644 --- a/metadata/org.projectmaxs.transport.xmpp.yml +++ b/metadata/org.projectmaxs.transport.xmpp.yml @@ -9,7 +9,6 @@ FlattrID: '2148361' Bitcoin: 17hnvYUhfGqnF8MQhQRsqttySn6fe9ebtp AutoName: MAXS Transport XMPP -Summary: XMPP Transport for MAXS Description: |- This is the XMPP Transport for MAXS, which does not install any launcher. You need "MAXS Main" and preferably some MAXS Modules to make use of it! diff --git a/metadata/org.projectmaxs.transport.xmpp/en-US/summary.txt b/metadata/org.projectmaxs.transport.xmpp/en-US/summary.txt new file mode 100644 index 0000000000..9831d58f48 --- /dev/null +++ b/metadata/org.projectmaxs.transport.xmpp/en-US/summary.txt @@ -0,0 +1 @@ +XMPP Transport for MAXS diff --git a/metadata/org.projectvoodoo.otarootkeeper.yml b/metadata/org.projectvoodoo.otarootkeeper.yml index 808e6c7e63..30d41684c5 100644 --- a/metadata/org.projectvoodoo.otarootkeeper.yml +++ b/metadata/org.projectvoodoo.otarootkeeper.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/project-voodoo/ota-rootkeeper-app/issues Donate: https://www.paypal.com/cgi-bin/webscr?cmd=_donations&business=curio%40free%2efr&item_name=Donate%20to%20Supercurio AutoName: Voodoo OTA RootKeeper -Summary: Maintain root access Description: |- '''Does not work for Android 4.3 updates''' diff --git a/metadata/org.projectvoodoo.otarootkeeper/en-US/summary.txt b/metadata/org.projectvoodoo.otarootkeeper/en-US/summary.txt new file mode 100644 index 0000000000..9d8f185649 --- /dev/null +++ b/metadata/org.projectvoodoo.otarootkeeper/en-US/summary.txt @@ -0,0 +1 @@ +Maintain root access diff --git a/metadata/org.projectvoodoo.screentestpatterns.yml b/metadata/org.projectvoodoo.screentestpatterns.yml index db8575ef21..f361119592 100644 --- a/metadata/org.projectvoodoo.screentestpatterns.yml +++ b/metadata/org.projectvoodoo.screentestpatterns.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/project-voodoo/screen-test-patterns-app IssueTracker: https://github.com/project-voodoo/screen-test-patterns-app/issues AutoName: Voodoo Screen Test Patterns -Summary: Produce colours for testing Description: |- This app display simple colors on your screen; those colors are then measured by a colorimeter or spectrophotometer (such as diff --git a/metadata/org.projectvoodoo.screentestpatterns/en-US/summary.txt b/metadata/org.projectvoodoo.screentestpatterns/en-US/summary.txt new file mode 100644 index 0000000000..6d8455d7d5 --- /dev/null +++ b/metadata/org.projectvoodoo.screentestpatterns/en-US/summary.txt @@ -0,0 +1 @@ +Produce colours for testing diff --git a/metadata/org.projectvoodoo.simplecarrieriqdetector.yml b/metadata/org.projectvoodoo.simplecarrieriqdetector.yml index b7049eab35..c42395af3c 100644 --- a/metadata/org.projectvoodoo.simplecarrieriqdetector.yml +++ b/metadata/org.projectvoodoo.simplecarrieriqdetector.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/project-voodoo/simple_carrieriq_detector_app IssueTracker: https://github.com/project-voodoo/simple_carrieriq_detector_app/issues AutoName: Voodoo CarrierIQ Detector -Summary: Check for Carrier IQ spyware on the device Description: |- This is a naive app that tells if your phone seems to host CarrierIQ elements or not. CarrierIQ is a diagnostics tool that comes embedded in the firmware of diff --git a/metadata/org.projectvoodoo.simplecarrieriqdetector/en-US/summary.txt b/metadata/org.projectvoodoo.simplecarrieriqdetector/en-US/summary.txt new file mode 100644 index 0000000000..3f95305d8e --- /dev/null +++ b/metadata/org.projectvoodoo.simplecarrieriqdetector/en-US/summary.txt @@ -0,0 +1 @@ +Check for Carrier IQ spyware on the device diff --git a/metadata/org.safermobile.intheclear.yml b/metadata/org.safermobile.intheclear.yml index bfa1550328..9a669f1b6b 100644 --- a/metadata/org.safermobile.intheclear.yml +++ b/metadata/org.safermobile.intheclear.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/SaferMobile/intheclear IssueTracker: https://github.com/SaferMobile/intheclear/issues AutoName: InTheClear -Summary: Alerting and secure wipe Description: |- InTheClear is a suite of mobile applications designed to keep users safer in difficult situations by using their phone's built-in tools. At its core are two diff --git a/metadata/org.safermobile.intheclear/en-US/summary.txt b/metadata/org.safermobile.intheclear/en-US/summary.txt new file mode 100644 index 0000000000..3220adb26e --- /dev/null +++ b/metadata/org.safermobile.intheclear/en-US/summary.txt @@ -0,0 +1 @@ +Alerting and secure wipe diff --git a/metadata/org.sagemath.droid.yml b/metadata/org.sagemath.droid.yml index d96f620dcc..c412064d5c 100644 --- a/metadata/org.sagemath.droid.yml +++ b/metadata/org.sagemath.droid.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/sagemath/android IssueTracker: https://github.com/sagemath/android/issues AutoName: Sage -Summary: Calculation client Description: |- Sage is mathematical software that combines many packages into a common interface. This Android application connects as a http client to a Sage server, diff --git a/metadata/org.sagemath.droid/en-US/summary.txt b/metadata/org.sagemath.droid/en-US/summary.txt new file mode 100644 index 0000000000..f6a9ef2874 --- /dev/null +++ b/metadata/org.sagemath.droid/en-US/summary.txt @@ -0,0 +1 @@ +Calculation client diff --git a/metadata/org.saiditnet.redreader.yml b/metadata/org.saiditnet.redreader.yml index ba04d845f9..c840bd95fd 100644 --- a/metadata/org.saiditnet.redreader.yml +++ b/metadata/org.saiditnet.redreader.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/libertysoft3/RedReader/issues Changelog: https://github.com/libertysoft3/RedReader/blob/HEAD/assets/changelog.txt AutoName: SaidIt -Summary: Client for saidit.net Description: |- An official client for news site saidit.net. This app is a fork of QuantumBadger's RedReader. diff --git a/metadata/org.saiditnet.redreader/en-US/summary.txt b/metadata/org.saiditnet.redreader/en-US/summary.txt new file mode 100644 index 0000000000..99661ac5d2 --- /dev/null +++ b/metadata/org.saiditnet.redreader/en-US/summary.txt @@ -0,0 +1 @@ +Client for saidit.net diff --git a/metadata/org.sasehash.burgerwp.yml b/metadata/org.sasehash.burgerwp.yml index 0da5c7987d..1413c68865 100644 --- a/metadata/org.sasehash.burgerwp.yml +++ b/metadata/org.sasehash.burgerwp.yml @@ -6,7 +6,6 @@ IssueTracker: https://gitlab.com/samsumas/LivingBurger/issues Changelog: https://gitlab.com/samsumas/LivingBurger/tags AutoName: BurgerWP -Summary: Get rid of your old boring Wallpaper and replace it with burgers and pizza Description: |- Very nice Wallpaper featuring some pizza and burger. Burger and pizzas bounces around. Fork me on GitLab! diff --git a/metadata/org.sasehash.burgerwp/en-US/summary.txt b/metadata/org.sasehash.burgerwp/en-US/summary.txt new file mode 100644 index 0000000000..49437fcc21 --- /dev/null +++ b/metadata/org.sasehash.burgerwp/en-US/summary.txt @@ -0,0 +1 @@ +Get rid of your old boring Wallpaper and replace it with burgers and pizza diff --git a/metadata/org.schabi.etherwake.yml b/metadata/org.schabi.etherwake.yml index 01fd44dbb6..aee6dd6d79 100644 --- a/metadata/org.schabi.etherwake.yml +++ b/metadata/org.schabi.etherwake.yml @@ -5,7 +5,6 @@ SourceCode: https://gitlab.com/derSchabi/Etherwake-app IssueTracker: https://gitlab.com/derSchabi/Etherwake-app/issues AutoName: Etherwake -Summary: Wake computers on the same network Description: |- Wraper around the ehterwake command. It is used to start computers within the same network as the smartphone. Since this app sends pure ethernetframes it diff --git a/metadata/org.schabi.etherwake/en-US/summary.txt b/metadata/org.schabi.etherwake/en-US/summary.txt new file mode 100644 index 0000000000..492477086f --- /dev/null +++ b/metadata/org.schabi.etherwake/en-US/summary.txt @@ -0,0 +1 @@ +Wake computers on the same network diff --git a/metadata/org.schabi.kiba.yml b/metadata/org.schabi.kiba.yml index b98fa58a9c..a9ff2f190b 100644 --- a/metadata/org.schabi.kiba.yml +++ b/metadata/org.schabi.kiba.yml @@ -7,7 +7,6 @@ IssueTracker: https://savannah.nongnu.org/bugs/?func=additem&group=kiba Changelog: https://git.savannah.gnu.org/cgit/kiba.git/log AutoName: KIBA -Summary: A booth attraction app Description: |- A simple android app to control the LED Plussy Display by Christian Carlowitz. It was created in order to promote the FSFE and its Fellowship campaign, as well diff --git a/metadata/org.schabi.kiba/en-US/summary.txt b/metadata/org.schabi.kiba/en-US/summary.txt new file mode 100644 index 0000000000..d29b1916ec --- /dev/null +++ b/metadata/org.schabi.kiba/en-US/summary.txt @@ -0,0 +1 @@ +A booth attraction app diff --git a/metadata/org.schabi.newpipe.yml b/metadata/org.schabi.newpipe.yml index d2135854a7..e7c2c39028 100644 --- a/metadata/org.schabi.newpipe.yml +++ b/metadata/org.schabi.newpipe.yml @@ -12,7 +12,6 @@ LiberapayID: '34969' Bitcoin: 16A9J59ahMRqkLSZjhYj33n9j3fMztFxnh AutoName: NewPipe -Summary: Lightweight YouTube frontend Description: |- Lightweight YouTube frontend that's supposed to be used without the proprietary YouTube-API or any of Google's (proprietary) play-services. NewPipe only parses diff --git a/metadata/org.schabi.newpipe/en-US/summary.txt b/metadata/org.schabi.newpipe/en-US/summary.txt new file mode 100644 index 0000000000..5694271450 --- /dev/null +++ b/metadata/org.schabi.newpipe/en-US/summary.txt @@ -0,0 +1 @@ +Lightweight YouTube frontend diff --git a/metadata/org.schabi.nxbookmarks.owncloud.yml b/metadata/org.schabi.nxbookmarks.owncloud.yml index ddc4accfcd..e98589932b 100644 --- a/metadata/org.schabi.nxbookmarks.owncloud.yml +++ b/metadata/org.schabi.nxbookmarks.owncloud.yml @@ -7,7 +7,6 @@ IssueTracker: https://gitlab.com/derSchabi/OCBookmarks/issues Changelog: https://gitlab.com/derSchabi/OCBookmarks/blob/HEAD/CHANGELOG.md AutoName: OwnCloud Bookmarks -Summary: A front end for the Nextcloud Bookmark app Description: |- An Android front end for the Nextcloud/Owncloud Bookmark App based on the new REST API that was introduced by Bookmarks version 0.10.2 With this app you can diff --git a/metadata/org.schabi.nxbookmarks.owncloud/en-US/summary.txt b/metadata/org.schabi.nxbookmarks.owncloud/en-US/summary.txt new file mode 100644 index 0000000000..b3de42fcec --- /dev/null +++ b/metadata/org.schabi.nxbookmarks.owncloud/en-US/summary.txt @@ -0,0 +1 @@ +A front end for the Nextcloud Bookmark app diff --git a/metadata/org.schabi.nxbookmarks.yml b/metadata/org.schabi.nxbookmarks.yml index 002daab0c9..7a7858892f 100644 --- a/metadata/org.schabi.nxbookmarks.yml +++ b/metadata/org.schabi.nxbookmarks.yml @@ -7,7 +7,6 @@ IssueTracker: https://gitlab.com/derSchabi/OCBookmarks/issues Changelog: https://gitlab.com/derSchabi/OCBookmarks/blob/HEAD/CHANGELOG.md AutoName: Nextcloud Bookmarks -Summary: A front end for the Nextcloud Bookmark app Description: |- An Android front end for the Nextcloud/Owncloud Bookmark App based on the new REST API that was introduced by Bookmarks version 0.10.1 With this app you can diff --git a/metadata/org.schabi.nxbookmarks/en-US/summary.txt b/metadata/org.schabi.nxbookmarks/en-US/summary.txt new file mode 100644 index 0000000000..b3de42fcec --- /dev/null +++ b/metadata/org.schabi.nxbookmarks/en-US/summary.txt @@ -0,0 +1 @@ +A front end for the Nextcloud Bookmark app diff --git a/metadata/org.schabi.openhitboxstreams.yml b/metadata/org.schabi.openhitboxstreams.yml index b7c0fd45d8..cab54e1fd2 100644 --- a/metadata/org.schabi.openhitboxstreams.yml +++ b/metadata/org.schabi.openhitboxstreams.yml @@ -10,7 +10,6 @@ Changelog: https://gitlab.com/derSchabi/OpenHitboxStreams/blob/HEAD/CHANGELOG.md Bitcoin: 16A9J59ahMRqkLSZjhYj33n9j3fMztFxnh AutoName: OpenHitboxStreams -Summary: Open hitbox.tv stream via intent Description: |- Opens Hitbox.tv streams from Intent. So for example open it from firefox, and choose your favorite player. diff --git a/metadata/org.schabi.openhitboxstreams/en-US/summary.txt b/metadata/org.schabi.openhitboxstreams/en-US/summary.txt new file mode 100644 index 0000000000..2ac537ba2d --- /dev/null +++ b/metadata/org.schabi.openhitboxstreams/en-US/summary.txt @@ -0,0 +1 @@ +Open hitbox.tv stream via intent diff --git a/metadata/org.schabi.stethox.yml b/metadata/org.schabi.stethox.yml index 8e42a3bc66..f73707af1e 100644 --- a/metadata/org.schabi.stethox.yml +++ b/metadata/org.schabi.stethox.yml @@ -6,7 +6,6 @@ SourceCode: https://gitlab.com/derSchabi/Stethox IssueTracker: https://gitlab.com/derSchabi/Stethox/issues AutoName: Stethox -Summary: Xposed module that adds Stetho to every app Description: |- This is a Xposed Module that enables Stetho for every application on your phone. All Stetho functions are given besides Network Monitoring. For this diff --git a/metadata/org.schabi.stethox/en-US/summary.txt b/metadata/org.schabi.stethox/en-US/summary.txt new file mode 100644 index 0000000000..56957b0ebf --- /dev/null +++ b/metadata/org.schabi.stethox/en-US/summary.txt @@ -0,0 +1 @@ +Xposed module that adds Stetho to every app diff --git a/metadata/org.schabi.svgredirect.yml b/metadata/org.schabi.svgredirect.yml index 31418b6fbf..f8252b736c 100644 --- a/metadata/org.schabi.svgredirect.yml +++ b/metadata/org.schabi.svgredirect.yml @@ -6,7 +6,6 @@ IssueTracker: https://gitlab.com/derSchabi/SVG-redirect/issues Changelog: https://gitlab.com/derSchabi/SVG-redirect/blob/HEAD/CHANGELOG.md AutoName: SVG redirect -Summary: Open SVG files with your browser Description: |- By default Android can't handle SVG files, when you try to open them from a file manager. A Browser could handle SVG, but the most of them don't allow to call diff --git a/metadata/org.schabi.svgredirect/en-US/summary.txt b/metadata/org.schabi.svgredirect/en-US/summary.txt new file mode 100644 index 0000000000..0e701fc1b8 --- /dev/null +++ b/metadata/org.schabi.svgredirect/en-US/summary.txt @@ -0,0 +1 @@ +Open SVG files with your browser diff --git a/metadata/org.schabi.terminightor.yml b/metadata/org.schabi.terminightor.yml index 23ed91ab0c..3b57496cc8 100644 --- a/metadata/org.schabi.terminightor.yml +++ b/metadata/org.schabi.terminightor.yml @@ -6,7 +6,6 @@ IssueTracker: https://gitlab.com/derSchabi/Terminightor/issues Changelog: https://gitlab.com/derSchabi/Terminightor/blob/HEAD/CHANGELOG.md AutoName: Terminightor -Summary: Alarm clock based on NFC tags Description: |- A simple alarm clock with a spicy special: In order to put off an alarm, you have to hold a NFC tag onto your phone. Unless you do that the alarm will not diff --git a/metadata/org.schabi.terminightor/en-US/summary.txt b/metadata/org.schabi.terminightor/en-US/summary.txt new file mode 100644 index 0000000000..a12774ec26 --- /dev/null +++ b/metadata/org.schabi.terminightor/en-US/summary.txt @@ -0,0 +1 @@ +Alarm clock based on NFC tags diff --git a/metadata/org.scid.android.yml b/metadata/org.scid.android.yml index 41acc1f1e5..29a01fbf5b 100644 --- a/metadata/org.scid.android.yml +++ b/metadata/org.scid.android.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/gkalab/scidonthego IssueTracker: https://github.com/gkalab/scidonthego/issues AutoName: Scid on the go -Summary: View chess games Description: A browser for Scid chess database files for Android. RepoType: git diff --git a/metadata/org.scid.android/en-US/summary.txt b/metadata/org.scid.android/en-US/summary.txt new file mode 100644 index 0000000000..7c41c05fc2 --- /dev/null +++ b/metadata/org.scid.android/en-US/summary.txt @@ -0,0 +1 @@ +View chess games diff --git a/metadata/org.scoutant.blokish.yml b/metadata/org.scoutant.blokish.yml index fc692ac2fc..05a37a5254 100644 --- a/metadata/org.scoutant.blokish.yml +++ b/metadata/org.scoutant.blokish.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/scoutant/blokish/issues Changelog: https://github.com/scoutant/blokish/blob/HEAD/README.md#changelog AutoName: Blokish -Summary: Board game Description: |- A strategy board game. diff --git a/metadata/org.scoutant.blokish/en-US/summary.txt b/metadata/org.scoutant.blokish/en-US/summary.txt new file mode 100644 index 0000000000..547f914cc4 --- /dev/null +++ b/metadata/org.scoutant.blokish/en-US/summary.txt @@ -0,0 +1 @@ +Board game diff --git a/metadata/org.scoutant.cc.yml b/metadata/org.scoutant.cc.yml index 6e8eeac3b6..18ed7f1796 100644 --- a/metadata/org.scoutant.cc.yml +++ b/metadata/org.scoutant.cc.yml @@ -4,7 +4,6 @@ License: GPL-3.0-only WebSite: http://chinese-checkers.scoutant.org AutoName: Chinese Checkers -Summary: Board game Description: |- A traditional strategy game to be played on a tablet. Play with up to 6 players, or against the machine. diff --git a/metadata/org.scoutant.cc/en-US/summary.txt b/metadata/org.scoutant.cc/en-US/summary.txt new file mode 100644 index 0000000000..547f914cc4 --- /dev/null +++ b/metadata/org.scoutant.cc/en-US/summary.txt @@ -0,0 +1 @@ +Board game diff --git a/metadata/org.scoutant.rpn.yml b/metadata/org.scoutant.rpn.yml index 0c1721c82e..7e02c7fa72 100644 --- a/metadata/org.scoutant.rpn.yml +++ b/metadata/org.scoutant.rpn.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/scoutant/rpn IssueTracker: https://github.com/scoutant/rpn/issues AutoName: RPN -Summary: Very easy to use RPN Calculator Description: |- Very handy calculator, in Reverse Polish Notation style. Written in Kotlin. diff --git a/metadata/org.scoutant.rpn/en-US/summary.txt b/metadata/org.scoutant.rpn/en-US/summary.txt new file mode 100644 index 0000000000..14ac75c613 --- /dev/null +++ b/metadata/org.scoutant.rpn/en-US/summary.txt @@ -0,0 +1 @@ +Very easy to use RPN Calculator diff --git a/metadata/org.scummvm.scummvm.yml b/metadata/org.scummvm.scummvm.yml index 52eec1f8b0..86b7c65d6f 100644 --- a/metadata/org.scummvm.scummvm.yml +++ b/metadata/org.scummvm.scummvm.yml @@ -7,7 +7,6 @@ IssueTracker: https://bugs.scummvm.org/ Donate: https://sourceforge.net/p/scummvm/donate Name: ScummVM -Summary: Adventure game player Description: |- ScummVM is a program which allows you to run certain classic graphical point-and-click adventure games, provided you already have their data files. diff --git a/metadata/org.scummvm.scummvm/en-US/summary.txt b/metadata/org.scummvm.scummvm/en-US/summary.txt new file mode 100644 index 0000000000..dccf8365e8 --- /dev/null +++ b/metadata/org.scummvm.scummvm/en-US/summary.txt @@ -0,0 +1 @@ +Adventure game player diff --git a/metadata/org.seamapdroid.yml b/metadata/org.seamapdroid.yml index 2e34f6f633..3adea240bc 100644 --- a/metadata/org.seamapdroid.yml +++ b/metadata/org.seamapdroid.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/marcoM32/SeaMapDroid IssueTracker: https://github.com/marcoM32/SeaMapDroid/issues AutoName: SeaMapDroid -Summary: Browse OpenSeaMap on your phone Description: |- An Android application to consult the libre online nautical maps OpenSeaMap. diff --git a/metadata/org.seamapdroid/en-US/summary.txt b/metadata/org.seamapdroid/en-US/summary.txt new file mode 100644 index 0000000000..5382bf8242 --- /dev/null +++ b/metadata/org.seamapdroid/en-US/summary.txt @@ -0,0 +1 @@ +Browse OpenSeaMap on your phone diff --git a/metadata/org.secuso.privacyfriendly2048.yml b/metadata/org.secuso.privacyfriendly2048.yml index 51e4edecde..dbbd1b4a22 100644 --- a/metadata/org.secuso.privacyfriendly2048.yml +++ b/metadata/org.secuso.privacyfriendly2048.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-2048/issues Changelog: https://github.com/SecUSo/privacy-friendly-2048/blob/HEAD/CHANGELOG.md AutoName: '2048' -Summary: Try to reach 2048 in this puzzle game Description: | The application Privacy Friendly 2048 is an exciting puzzle game. The game is considered to be won if you reach the number 2048 by sliding the same diff --git a/metadata/org.secuso.privacyfriendly2048/en-US/summary.txt b/metadata/org.secuso.privacyfriendly2048/en-US/summary.txt new file mode 100644 index 0000000000..5377d28700 --- /dev/null +++ b/metadata/org.secuso.privacyfriendly2048/en-US/summary.txt @@ -0,0 +1 @@ +Try to reach 2048 in this puzzle game diff --git a/metadata/org.secuso.privacyfriendlyactivitytracker.yml b/metadata/org.secuso.privacyfriendlyactivitytracker.yml index e2df072708..b79b05a4b6 100644 --- a/metadata/org.secuso.privacyfriendlyactivitytracker.yml +++ b/metadata/org.secuso.privacyfriendlyactivitytracker.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-pedometer/issues Changelog: https://github.com/SecUSo/privacy-friendly-pedometer/blob/HEAD/CHANGELOG.md AutoName: Pedometer -Summary: Count steps Description: |- Count your steps in background to provide you an overview about your walked steps, distance and about the calories you have burned while walking. The app diff --git a/metadata/org.secuso.privacyfriendlyactivitytracker/en-US/summary.txt b/metadata/org.secuso.privacyfriendlyactivitytracker/en-US/summary.txt new file mode 100644 index 0000000000..8af8697631 --- /dev/null +++ b/metadata/org.secuso.privacyfriendlyactivitytracker/en-US/summary.txt @@ -0,0 +1 @@ +Count steps diff --git a/metadata/org.secuso.privacyfriendlyboardgameclock.yml b/metadata/org.secuso.privacyfriendlyboardgameclock.yml index 7a4da1b938..54dee274ad 100644 --- a/metadata/org.secuso.privacyfriendlyboardgameclock.yml +++ b/metadata/org.secuso.privacyfriendlyboardgameclock.yml @@ -8,7 +8,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-boardgame-clock/issues Changelog: https://github.com/SecUSo/privacy-friendly-boardgame-clock/blob/HEAD/CHANGELOG.md AutoName: Board Game Clock -Summary: A timer for board games like chess Description: | Privacy Friendly Boardgames Clock offers stopwatches and timers to support time tracking while playing boardgames. The app offers different modes depending on the game that is played. If the game is round based players and round diff --git a/metadata/org.secuso.privacyfriendlyboardgameclock/en-US/summary.txt b/metadata/org.secuso.privacyfriendlyboardgameclock/en-US/summary.txt new file mode 100644 index 0000000000..6ca16d06d0 --- /dev/null +++ b/metadata/org.secuso.privacyfriendlyboardgameclock/en-US/summary.txt @@ -0,0 +1 @@ +A timer for board games like chess diff --git a/metadata/org.secuso.privacyfriendlycardgameone.yml b/metadata/org.secuso.privacyfriendlycardgameone.yml index c6bc046c3a..c05171901f 100644 --- a/metadata/org.secuso.privacyfriendlycardgameone.yml +++ b/metadata/org.secuso.privacyfriendlycardgameone.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-werewolf/issues Changelog: https://github.com/SecUSo/privacy-friendly-werewolf/blob/HEAD/CHANGELOG.md AutoName: Werewolf -Summary: Play Werewolf with your friends Description: |- Privacy Friendly Werewolf is an open source Android implementation of the famous Werewolf card game. You can play it with your friends inside a local network, so diff --git a/metadata/org.secuso.privacyfriendlycardgameone/en-US/summary.txt b/metadata/org.secuso.privacyfriendlycardgameone/en-US/summary.txt new file mode 100644 index 0000000000..1afe64d9ae --- /dev/null +++ b/metadata/org.secuso.privacyfriendlycardgameone/en-US/summary.txt @@ -0,0 +1 @@ +Play Werewolf with your friends diff --git a/metadata/org.secuso.privacyfriendlydame.yml b/metadata/org.secuso.privacyfriendlydame.yml index c7aafa8129..fac44e7a8f 100644 --- a/metadata/org.secuso.privacyfriendlydame.yml +++ b/metadata/org.secuso.privacyfriendlydame.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-dame/issues Changelog: https://github.com/SecUSo/privacy-friendly-dame/blob/HEAD/CHANGELOG.md AutoName: Checkers -Summary: Strategy board game for one or two players Description: |- Privacy Friendly Checkers is a strategy board game for two players. The objective of the game is to either capture all opposing game pieces by jumping diff --git a/metadata/org.secuso.privacyfriendlydame/en-US/summary.txt b/metadata/org.secuso.privacyfriendlydame/en-US/summary.txt new file mode 100644 index 0000000000..abe1f1d8da --- /dev/null +++ b/metadata/org.secuso.privacyfriendlydame/en-US/summary.txt @@ -0,0 +1 @@ +Strategy board game for one or two players diff --git a/metadata/org.secuso.privacyfriendlydicer.yml b/metadata/org.secuso.privacyfriendlydicer.yml index cdc8f8f630..8ea4d3a5f0 100644 --- a/metadata/org.secuso.privacyfriendlydicer.yml +++ b/metadata/org.secuso.privacyfriendlydicer.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-dicer/issues Changelog: https://github.com/SecUSo/privacy-friendly-dicer/blob/HEAD/CHANGELOG.md AutoName: Dicer -Summary: Roll dices Description: |- Simple dicing application which can be used to roll up to ten six-sided dice. Dicing can be done by pressing a button or shaking the smart phone. It belongs diff --git a/metadata/org.secuso.privacyfriendlydicer/en-US/summary.txt b/metadata/org.secuso.privacyfriendlydicer/en-US/summary.txt new file mode 100644 index 0000000000..7dafd6927d --- /dev/null +++ b/metadata/org.secuso.privacyfriendlydicer/en-US/summary.txt @@ -0,0 +1 @@ +Roll dices diff --git a/metadata/org.secuso.privacyfriendlyintervaltimer.yml b/metadata/org.secuso.privacyfriendlyintervaltimer.yml index 05adbdd111..ed87838a6e 100644 --- a/metadata/org.secuso.privacyfriendlyintervaltimer.yml +++ b/metadata/org.secuso.privacyfriendlyintervaltimer.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-interval-timer/issues Changelog: https://github.com/SecUSo/privacy-friendly-interval-timer/blob/HEAD/CHANGELOG.md AutoName: Interval Timer -Summary: Privacy Friendly App that supports you during circuit exercise sessions Description: |- Privacy Friendly Interval Timer supports the user during his/her circuit training session and helps him achieve his/her training goals. In order to diff --git a/metadata/org.secuso.privacyfriendlyintervaltimer/en-US/summary.txt b/metadata/org.secuso.privacyfriendlyintervaltimer/en-US/summary.txt new file mode 100644 index 0000000000..0408e2b097 --- /dev/null +++ b/metadata/org.secuso.privacyfriendlyintervaltimer/en-US/summary.txt @@ -0,0 +1 @@ +Privacy Friendly App that supports you during circuit exercise sessions diff --git a/metadata/org.secuso.privacyfriendlyludo.yml b/metadata/org.secuso.privacyfriendlyludo.yml index c1c8256e0c..7d734eef54 100644 --- a/metadata/org.secuso.privacyfriendlyludo.yml +++ b/metadata/org.secuso.privacyfriendlyludo.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-ludo/issues Changelog: https://github.com/SecUSo/privacy-friendly-ludo/blob/HEAD/CHANGELOG.md AutoName: Ludo -Summary: Boardgame for 1 up to 6 players Description: |- Privacy Friendly Ludo is a boardgame for 4 up to 6 players (persons or computer opponents). The goal of the game is bringing four figures to the goal fields. diff --git a/metadata/org.secuso.privacyfriendlyludo/en-US/summary.txt b/metadata/org.secuso.privacyfriendlyludo/en-US/summary.txt new file mode 100644 index 0000000000..d216d83d14 --- /dev/null +++ b/metadata/org.secuso.privacyfriendlyludo/en-US/summary.txt @@ -0,0 +1 @@ +Boardgame for 1 up to 6 players diff --git a/metadata/org.secuso.privacyfriendlymemory.yml b/metadata/org.secuso.privacyfriendlymemory.yml index 27c55558de..815391f715 100644 --- a/metadata/org.secuso.privacyfriendlymemory.yml +++ b/metadata/org.secuso.privacyfriendlymemory.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-memo-game/issues Changelog: https://github.com/SecUSo/privacy-friendly-memo-game/blob/HEAD/CHANGELOG.md AutoName: Memo Game -Summary: Find pairs of cards Description: |- Card game with the goal to find pairs. This app is optimized regarding the user's privacy. It doesn't use any tracking mechanisms, neither it displays any diff --git a/metadata/org.secuso.privacyfriendlymemory/en-US/summary.txt b/metadata/org.secuso.privacyfriendlymemory/en-US/summary.txt new file mode 100644 index 0000000000..221a0f2fa9 --- /dev/null +++ b/metadata/org.secuso.privacyfriendlymemory/en-US/summary.txt @@ -0,0 +1 @@ +Find pairs of cards diff --git a/metadata/org.secuso.privacyfriendlyminesweeper.yml b/metadata/org.secuso.privacyfriendlyminesweeper.yml index 3f3e99e7cf..37d2967803 100644 --- a/metadata/org.secuso.privacyfriendlyminesweeper.yml +++ b/metadata/org.secuso.privacyfriendlyminesweeper.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-minesweeper/issues Changelog: https://github.com/SecUSo/privacy-friendly-minesweeper/blob/HEAD/CHANGELOG.md AutoName: Minesweeper -Summary: Find and mark every mine without triggering the mines Description: | Privacy Friendly Minesweeper is a moblie version of the classic game Minesweeper. The goal of the game is to find and mark every mine without triggering one of them. diff --git a/metadata/org.secuso.privacyfriendlyminesweeper/en-US/summary.txt b/metadata/org.secuso.privacyfriendlyminesweeper/en-US/summary.txt new file mode 100644 index 0000000000..9db3f14213 --- /dev/null +++ b/metadata/org.secuso.privacyfriendlyminesweeper/en-US/summary.txt @@ -0,0 +1 @@ +Find and mark every mine without triggering the mines diff --git a/metadata/org.secuso.privacyfriendlynetmonitor.yml b/metadata/org.secuso.privacyfriendlynetmonitor.yml index d12842f0e3..952e51d565 100644 --- a/metadata/org.secuso.privacyfriendlynetmonitor.yml +++ b/metadata/org.secuso.privacyfriendlynetmonitor.yml @@ -8,7 +8,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-netmonitor/issues Changelog: https://github.com/SecUSo/privacy-friendly-netmonitor/blob/HEAD/CHANGELOG.md AutoName: Net Monitor -Summary: Shows network connections of installed apps Description: |- Privacy Friendly Net Monitor monitors active network activity and provides information on the scanned connections and apps. The Connection's local and diff --git a/metadata/org.secuso.privacyfriendlynetmonitor/en-US/summary.txt b/metadata/org.secuso.privacyfriendlynetmonitor/en-US/summary.txt new file mode 100644 index 0000000000..ef8acbf129 --- /dev/null +++ b/metadata/org.secuso.privacyfriendlynetmonitor/en-US/summary.txt @@ -0,0 +1 @@ +Shows network connections of installed apps diff --git a/metadata/org.secuso.privacyfriendlynotes.yml b/metadata/org.secuso.privacyfriendlynotes.yml index fec5711515..2f82d88a1a 100644 --- a/metadata/org.secuso.privacyfriendlynotes.yml +++ b/metadata/org.secuso.privacyfriendlynotes.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-notes/issues Changelog: https://github.com/SecUSo/privacy-friendly-notes/blob/HEAD/CHANGELOG.md AutoName: Notes -Summary: Take and manage notes Description: |- Create and manage notes. It is also possible to can define categories and assign them to the notes. Notes can have one of these types: diff --git a/metadata/org.secuso.privacyfriendlynotes/en-US/summary.txt b/metadata/org.secuso.privacyfriendlynotes/en-US/summary.txt new file mode 100644 index 0000000000..c5f91c9ced --- /dev/null +++ b/metadata/org.secuso.privacyfriendlynotes/en-US/summary.txt @@ -0,0 +1 @@ +Take and manage notes diff --git a/metadata/org.secuso.privacyfriendlypaindiary.yml b/metadata/org.secuso.privacyfriendlypaindiary.yml index 4b120dab50..cc6bd41efd 100644 --- a/metadata/org.secuso.privacyfriendlypaindiary.yml +++ b/metadata/org.secuso.privacyfriendlypaindiary.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-pain-diary/issues Changelog: https://github.com/SecUSo/privacy-friendly-pain-diary/blob/HEAD/CHANGELOG.md AutoName: Pain Diary -Summary: Helps you tracking pain Description: |- Privacy Friendly Pain Diary is an app which can help you track and share your pain. It allows you to make daily diary entries recording your condition and the diff --git a/metadata/org.secuso.privacyfriendlypaindiary/en-US/summary.txt b/metadata/org.secuso.privacyfriendlypaindiary/en-US/summary.txt new file mode 100644 index 0000000000..c9623c0969 --- /dev/null +++ b/metadata/org.secuso.privacyfriendlypaindiary/en-US/summary.txt @@ -0,0 +1 @@ +Helps you tracking pain diff --git a/metadata/org.secuso.privacyfriendlypasswordgenerator.yml b/metadata/org.secuso.privacyfriendlypasswordgenerator.yml index 17e5c8571c..87364d1c4d 100644 --- a/metadata/org.secuso.privacyfriendlypasswordgenerator.yml +++ b/metadata/org.secuso.privacyfriendlypasswordgenerator.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-passwordgenerator/issue Changelog: https://github.com/SecUSo/privacy-friendly-passwordgenerator/blob/HEAD/CHANGELOG.md AutoName: Password Generator -Summary: Generate passwords Description: |- With Privacy Friendly Password Generator you can generate different passwords for all your accounts while remembering only one master password. diff --git a/metadata/org.secuso.privacyfriendlypasswordgenerator/en-US/summary.txt b/metadata/org.secuso.privacyfriendlypasswordgenerator/en-US/summary.txt new file mode 100644 index 0000000000..7a61cd98f7 --- /dev/null +++ b/metadata/org.secuso.privacyfriendlypasswordgenerator/en-US/summary.txt @@ -0,0 +1 @@ +Generate passwords diff --git a/metadata/org.secuso.privacyfriendlypausinghealthily.yml b/metadata/org.secuso.privacyfriendlypausinghealthily.yml index 4ce8514c1d..a2866c3d8e 100644 --- a/metadata/org.secuso.privacyfriendlypausinghealthily.yml +++ b/metadata/org.secuso.privacyfriendlypausinghealthily.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-pausing-healthily/issue Changelog: https://github.com/SecUSo/privacy-friendly-pausing-healthily/releases AutoName: Pausing Healthily -Summary: Break reminder with helpful exercises Description: |- The application Privacy Friendly Pausing Healthily is an app that allows you to structure your work. It reminds you to take breaks during your work and offers diff --git a/metadata/org.secuso.privacyfriendlypausinghealthily/en-US/summary.txt b/metadata/org.secuso.privacyfriendlypausinghealthily/en-US/summary.txt new file mode 100644 index 0000000000..705dcefb45 --- /dev/null +++ b/metadata/org.secuso.privacyfriendlypausinghealthily/en-US/summary.txt @@ -0,0 +1 @@ +Break reminder with helpful exercises diff --git a/metadata/org.secuso.privacyfriendlypin.yml b/metadata/org.secuso.privacyfriendlypin.yml index f7cc95aae0..23eed51510 100644 --- a/metadata/org.secuso.privacyfriendlypin.yml +++ b/metadata/org.secuso.privacyfriendlypin.yml @@ -8,7 +8,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-pin-mnemonic/issues Changelog: https://github.com/SecUSo/privacy-friendly-pin-mnemonic/blob/HEAD/CHANGELOG.md AutoName: PIN Mnemonic -Summary: Helps you to memorize PIN codes Description: |- Provides strategies to memorize a 4-digit PIN. Therefore it determines whether the PIN forms a T9-word, underlies a mathematical rule or forms a date or year. diff --git a/metadata/org.secuso.privacyfriendlypin/en-US/summary.txt b/metadata/org.secuso.privacyfriendlypin/en-US/summary.txt new file mode 100644 index 0000000000..d1711089cd --- /dev/null +++ b/metadata/org.secuso.privacyfriendlypin/en-US/summary.txt @@ -0,0 +1 @@ +Helps you to memorize PIN codes diff --git a/metadata/org.secuso.privacyfriendlyrecknoningskills.yml b/metadata/org.secuso.privacyfriendlyrecknoningskills.yml index ee942df7bd..42fb624dcd 100644 --- a/metadata/org.secuso.privacyfriendlyrecknoningskills.yml +++ b/metadata/org.secuso.privacyfriendlyrecknoningskills.yml @@ -8,7 +8,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-reckoning-skills/issues Changelog: https://github.com/SecUSo/privacy-friendly-reckoning-skills/blob/HEAD/CHANGELOG.md AutoName: Reckoning Skills -Summary: Helps you improving your mental calculation skills Description: |- Privacy Friendly Reckoning Skills helps you improving your mental calculation skills in the four basic calculating operations. For each game, the player can diff --git a/metadata/org.secuso.privacyfriendlyrecknoningskills/en-US/summary.txt b/metadata/org.secuso.privacyfriendlyrecknoningskills/en-US/summary.txt new file mode 100644 index 0000000000..329cb4c958 --- /dev/null +++ b/metadata/org.secuso.privacyfriendlyrecknoningskills/en-US/summary.txt @@ -0,0 +1 @@ +Helps you improving your mental calculation skills diff --git a/metadata/org.secuso.privacyfriendlyruler.yml b/metadata/org.secuso.privacyfriendlyruler.yml index 1de6fbb67c..5e4857099c 100644 --- a/metadata/org.secuso.privacyfriendlyruler.yml +++ b/metadata/org.secuso.privacyfriendlyruler.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-ruler/issues Changelog: https://github.com/SecUSo/privacy-friendly-ruler/blob/HEAD/CHANGELOG.md AutoName: Ruler -Summary: Turn your mobile device into a ruler Description: |- Privacy Friendly Ruler turns the device screen into a ruler for quick measurements on the go. It can display rulers with either inch or centimeters as diff --git a/metadata/org.secuso.privacyfriendlyruler/en-US/summary.txt b/metadata/org.secuso.privacyfriendlyruler/en-US/summary.txt new file mode 100644 index 0000000000..864e29e459 --- /dev/null +++ b/metadata/org.secuso.privacyfriendlyruler/en-US/summary.txt @@ -0,0 +1 @@ +Turn your mobile device into a ruler diff --git a/metadata/org.secuso.privacyfriendlysudoku.yml b/metadata/org.secuso.privacyfriendlysudoku.yml index e75d205cf4..7d0037d37b 100644 --- a/metadata/org.secuso.privacyfriendlysudoku.yml +++ b/metadata/org.secuso.privacyfriendlysudoku.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-sudoku/issues Changelog: https://github.com/SecUSo/privacy-friendly-sudoku/blob/HEAD/CHANGELOG.md AutoName: Sudoku -Summary: Play Sudoku logic puzzle Description: |- Play the Sudoku logic puzzle. The app belongs to the group of Privacy Friendly Apps developed at the [https://secuso.org/ SECUSO research group] of Technische diff --git a/metadata/org.secuso.privacyfriendlysudoku/en-US/summary.txt b/metadata/org.secuso.privacyfriendlysudoku/en-US/summary.txt new file mode 100644 index 0000000000..0eb4e99efe --- /dev/null +++ b/metadata/org.secuso.privacyfriendlysudoku/en-US/summary.txt @@ -0,0 +1 @@ +Play Sudoku logic puzzle diff --git a/metadata/org.secuso.privacyfriendlytapemeasure.yml b/metadata/org.secuso.privacyfriendlytapemeasure.yml index 6638e70817..840e51a7b7 100644 --- a/metadata/org.secuso.privacyfriendlytapemeasure.yml +++ b/metadata/org.secuso.privacyfriendlytapemeasure.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/SecUSo/privacy-friendly-tape-measure IssueTracker: https://github.com/SecUSo/privacy-friendly-tape-measure/issues AutoName: Tape Measure -Summary: Turn your device into a tape measure or ruler Description: |- Privacy Friendly Tape Measure can measure the size of objects in pictures based on objects of known sizes (e.g. coins) in the same picture. Just find a coin or diff --git a/metadata/org.secuso.privacyfriendlytapemeasure/en-US/summary.txt b/metadata/org.secuso.privacyfriendlytapemeasure/en-US/summary.txt new file mode 100644 index 0000000000..c3b656041f --- /dev/null +++ b/metadata/org.secuso.privacyfriendlytapemeasure/en-US/summary.txt @@ -0,0 +1 @@ +Turn your device into a tape measure or ruler diff --git a/metadata/org.secuso.privacyfriendlytodolist.yml b/metadata/org.secuso.privacyfriendlytodolist.yml index 48a2cf255c..ecc724a8b7 100644 --- a/metadata/org.secuso.privacyfriendlytodolist.yml +++ b/metadata/org.secuso.privacyfriendlytodolist.yml @@ -8,7 +8,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-todo-list/issues Changelog: https://github.com/SecUSo/privacy-friendly-todo-list/blob/HEAD/CHANGELOG.md AutoName: To-Do List -Summary: Keep a list of tasks Description: |- Create and manage tasks and To-Do lists. Each task can be subdivided into subtasks. It is possible to assign deadlines and a reminder service to get diff --git a/metadata/org.secuso.privacyfriendlytodolist/en-US/summary.txt b/metadata/org.secuso.privacyfriendlytodolist/en-US/summary.txt new file mode 100644 index 0000000000..a07274d52c --- /dev/null +++ b/metadata/org.secuso.privacyfriendlytodolist/en-US/summary.txt @@ -0,0 +1 @@ +Keep a list of tasks diff --git a/metadata/org.secuso.privacyfriendlyweather.yml b/metadata/org.secuso.privacyfriendlyweather.yml index ecd2e01158..84448f06ec 100644 --- a/metadata/org.secuso.privacyfriendlyweather.yml +++ b/metadata/org.secuso.privacyfriendlyweather.yml @@ -10,7 +10,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-weather/issues Changelog: https://github.com/SecUSo/privacy-friendly-weather/blob/HEAD/CHANGELOG.md AutoName: Weather -Summary: Get weather information and forecast Description: |- Lets you watch the weather for cities and locations. This includes the current weather as well as a 5 day / 3 hour forecast. Furthermore, Privacy Friendly diff --git a/metadata/org.secuso.privacyfriendlyweather/en-US/summary.txt b/metadata/org.secuso.privacyfriendlyweather/en-US/summary.txt new file mode 100644 index 0000000000..2462f2d689 --- /dev/null +++ b/metadata/org.secuso.privacyfriendlyweather/en-US/summary.txt @@ -0,0 +1 @@ +Get weather information and forecast diff --git a/metadata/org.secuso.privacyfriendlywifimanager.yml b/metadata/org.secuso.privacyfriendlywifimanager.yml index 28ea744cd9..6c1b10f94f 100644 --- a/metadata/org.secuso.privacyfriendlywifimanager.yml +++ b/metadata/org.secuso.privacyfriendlywifimanager.yml @@ -9,7 +9,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-wifi-manager/issues Changelog: https://github.com/SecUSo/privacy-friendly-wifi-manager/blob/HEAD/CHANGELOG.md AutoName: WiFi Manager -Summary: Manages your device's WiFi based on your location Description: |- Privacy Friendly WiFi Manager helps you automatically turning on/off your Wi-Fi while you are not near a known WiFi network. The app keeps track of diff --git a/metadata/org.secuso.privacyfriendlywifimanager/en-US/summary.txt b/metadata/org.secuso.privacyfriendlywifimanager/en-US/summary.txt new file mode 100644 index 0000000000..430354bc62 --- /dev/null +++ b/metadata/org.secuso.privacyfriendlywifimanager/en-US/summary.txt @@ -0,0 +1 @@ +Manages your device's WiFi based on your location diff --git a/metadata/org.secuso.privacyfriendlyyahtzeedicer.yml b/metadata/org.secuso.privacyfriendlyyahtzeedicer.yml index 789ee4c425..7cc8e9ea71 100644 --- a/metadata/org.secuso.privacyfriendlyyahtzeedicer.yml +++ b/metadata/org.secuso.privacyfriendlyyahtzeedicer.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-dice-game/issues Changelog: https://github.com/SecUSo/privacy-friendly-dice-game/blob/HEAD/CHANGELOG.md AutoName: Dice Game -Summary: Play dice game with 5 dice Description: |- Privacy Friendly Dice Game is a very simple application to play a dice game with five dice. Particular dice can be saved for the next round by pressing them. A diff --git a/metadata/org.secuso.privacyfriendlyyahtzeedicer/en-US/summary.txt b/metadata/org.secuso.privacyfriendlyyahtzeedicer/en-US/summary.txt new file mode 100644 index 0000000000..c4562a1a13 --- /dev/null +++ b/metadata/org.secuso.privacyfriendlyyahtzeedicer/en-US/summary.txt @@ -0,0 +1 @@ +Play dice game with 5 dice diff --git a/metadata/org.segin.bfinterpreter.yml b/metadata/org.segin.bfinterpreter.yml index 8416dde12b..82bbc0d06d 100644 --- a/metadata/org.segin.bfinterpreter.yml +++ b/metadata/org.segin.bfinterpreter.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/segin/BFInterpreter IssueTracker: https://github.com/segin/BFInterpreter/issues AutoName: BF Interpreter -Summary: Brainfuck language interpreter Description: Implementation of the "Brainfuck" programming language. RepoType: git diff --git a/metadata/org.segin.bfinterpreter/en-US/summary.txt b/metadata/org.segin.bfinterpreter/en-US/summary.txt new file mode 100644 index 0000000000..2154020fb2 --- /dev/null +++ b/metadata/org.segin.bfinterpreter/en-US/summary.txt @@ -0,0 +1 @@ +Brainfuck language interpreter diff --git a/metadata/org.segin.ttleditor.yml b/metadata/org.segin.ttleditor.yml index 2db549e255..e49e61d4f0 100644 --- a/metadata/org.segin.ttleditor.yml +++ b/metadata/org.segin.ttleditor.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/segin/TTLEditor IssueTracker: https://github.com/segin/TTLEditor/issues AutoName: TTL Editor -Summary: Change TTL of networking packets Description: |- Simple graphical frontend for iptables to change the TTL (time-to-live) of packets sent over a given network interface. diff --git a/metadata/org.segin.ttleditor/en-US/summary.txt b/metadata/org.segin.ttleditor/en-US/summary.txt new file mode 100644 index 0000000000..c7877eaed1 --- /dev/null +++ b/metadata/org.segin.ttleditor/en-US/summary.txt @@ -0,0 +1 @@ +Change TTL of networking packets diff --git a/metadata/org.sensors2.osc.yml b/metadata/org.sensors2.osc.yml index 886da0aaa4..d9c916113e 100644 --- a/metadata/org.sensors2.osc.yml +++ b/metadata/org.sensors2.osc.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/SensorApps/Sensors2OSC/issues Changelog: https://github.com/SensorApps/Sensors2OSC/blob/HEAD/Changelog.md AutoName: Sensors2OSC -Summary: Send sensor data via Open Sound Control (OSC). Description: |- Read sensor data from your phone and send them to a receiver via Open Sound Control (OSC). diff --git a/metadata/org.sensors2.osc/en-US/summary.txt b/metadata/org.sensors2.osc/en-US/summary.txt new file mode 100644 index 0000000000..7608f65733 --- /dev/null +++ b/metadata/org.sensors2.osc/en-US/summary.txt @@ -0,0 +1 @@ +Send sensor data via Open Sound Control (OSC). diff --git a/metadata/org.sensors2.pd.yml b/metadata/org.sensors2.pd.yml index 2e0923acfd..621efe9453 100644 --- a/metadata/org.sensors2.pd.yml +++ b/metadata/org.sensors2.pd.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/SensorApps/Sensors2Pd IssueTracker: https://github.com/SensorApps/Sensors2Pd/issues AutoName: Sensors2Pd -Summary: Use sensor data in Puredata patches Description: |- Using sensor data in Puredata patches. Sensors are available as receivers in the patch. diff --git a/metadata/org.sensors2.pd/en-US/summary.txt b/metadata/org.sensors2.pd/en-US/summary.txt new file mode 100644 index 0000000000..b1b75eceda --- /dev/null +++ b/metadata/org.sensors2.pd/en-US/summary.txt @@ -0,0 +1 @@ +Use sensor data in Puredata patches diff --git a/metadata/org.servDroid.web.yml b/metadata/org.servDroid.web.yml index 46edd56e20..276545631a 100644 --- a/metadata/org.servDroid.web.yml +++ b/metadata/org.servDroid.web.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/joanpuigsanz/servdroid IssueTracker: https://github.com/joanpuigsanz/servdroid/issues AutoName: ServDroid -Summary: Web server Description: |- Auto start options diff --git a/metadata/org.servDroid.web/en-US/summary.txt b/metadata/org.servDroid.web/en-US/summary.txt new file mode 100644 index 0000000000..cb68c58c9f --- /dev/null +++ b/metadata/org.servDroid.web/en-US/summary.txt @@ -0,0 +1 @@ +Web server diff --git a/metadata/org.servalproject.yml b/metadata/org.servalproject.yml index a6d03d5014..7e327ba5ba 100644 --- a/metadata/org.servalproject.yml +++ b/metadata/org.servalproject.yml @@ -8,7 +8,6 @@ Changelog: https://github.com/servalproject/batphone/blob/development/CURRENT-RE Donate: http://www.servalproject.org/donations AutoName: Serval Mesh -Summary: Peer to peer communications Description: |- '''The Serval Project is seeking funds to develop a mesh extender which aims to work around the limitations caused by the lack of AdHoc mode in Android. Visit diff --git a/metadata/org.servalproject/en-US/summary.txt b/metadata/org.servalproject/en-US/summary.txt new file mode 100644 index 0000000000..c3b27e002b --- /dev/null +++ b/metadata/org.servalproject/en-US/summary.txt @@ -0,0 +1 @@ +Peer to peer communications diff --git a/metadata/org.shadowice.flocke.andotp.yml b/metadata/org.shadowice.flocke.andotp.yml index a7847ce9ec..763de8b23d 100644 --- a/metadata/org.shadowice.flocke.andotp.yml +++ b/metadata/org.shadowice.flocke.andotp.yml @@ -7,7 +7,6 @@ Changelog: https://github.com/andOTP/andOTP/releases Donate: https://paypal.me/flocke000 AutoName: andOTP -Summary: Open-source two-factor authentication App Description: |- andOTP is a two-factor authentication App for Android 4.4+. diff --git a/metadata/org.shadowice.flocke.andotp/en-US/summary.txt b/metadata/org.shadowice.flocke.andotp/en-US/summary.txt new file mode 100644 index 0000000000..7351b98b5a --- /dev/null +++ b/metadata/org.shadowice.flocke.andotp/en-US/summary.txt @@ -0,0 +1 @@ +Open-source two-factor authentication App diff --git a/metadata/org.shirakumo.ocelot.yml b/metadata/org.shirakumo.ocelot.yml index fd9e2ee717..f423ae5d0e 100644 --- a/metadata/org.shirakumo.ocelot.yml +++ b/metadata/org.shirakumo.ocelot.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/Shirakumo/ocelot IssueTracker: https://github.com/Shirakumo/ocelot/issues AutoName: Ocelot -Summary: Lichat client Description: |- A chat client for the Lichat protocol. diff --git a/metadata/org.shirakumo.ocelot/en-US/summary.txt b/metadata/org.shirakumo.ocelot/en-US/summary.txt new file mode 100644 index 0000000000..226f8e8583 --- /dev/null +++ b/metadata/org.shirakumo.ocelot/en-US/summary.txt @@ -0,0 +1 @@ +Lichat client diff --git a/metadata/org.shortcuts.yml b/metadata/org.shortcuts.yml index 7ab013b1d8..851c6445ce 100644 --- a/metadata/org.shortcuts.yml +++ b/metadata/org.shortcuts.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/PrivacyApps/calendar-contacts-shortcuts/issues Changelog: https://github.com/PrivacyApps/calendar-contacts-shortcuts/blob/HEAD/CHANGELOG AutoName: Shortcuts for Calendar/Contacts -Summary: Add shortcuts for new calendars and contacts Description: |- Lets you create shortcuts on your home screen, which directly open the dialog for a new calendar event or a new contact. diff --git a/metadata/org.shortcuts/en-US/summary.txt b/metadata/org.shortcuts/en-US/summary.txt new file mode 100644 index 0000000000..dfa174da5c --- /dev/null +++ b/metadata/org.shortcuts/en-US/summary.txt @@ -0,0 +1 @@ +Add shortcuts for new calendars and contacts diff --git a/metadata/org.sickstache.yml b/metadata/org.sickstache.yml index aac51f378a..7626875395 100644 --- a/metadata/org.sickstache.yml +++ b/metadata/org.sickstache.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/Buttink/sick-stache IssueTracker: https://github.com/Buttink/sick-stache/issues AutoName: SickStache -Summary: Sickbeard client Description: |- Sickbeard is a PVR application for newsgroups that searches for and manages your TV shows. This app connects to the Sickbeard server to manage the downloads etc. diff --git a/metadata/org.sickstache/en-US/summary.txt b/metadata/org.sickstache/en-US/summary.txt new file mode 100644 index 0000000000..3e50a4f848 --- /dev/null +++ b/metadata/org.sickstache/en-US/summary.txt @@ -0,0 +1 @@ +Sickbeard client diff --git a/metadata/org.sipdroid.sipua.yml b/metadata/org.sipdroid.sipua.yml index a832767760..797f74ce24 100644 --- a/metadata/org.sipdroid.sipua.yml +++ b/metadata/org.sipdroid.sipua.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/i-p-tel/sipdroid/issues Changelog: http://sipdroid.org/ AutoName: Sipdroid -Summary: A SIP (VOIP) client Description: |- A SIP (VOIP) client with video calling capabilities. Visit the website for more info. For optimal battery usage reserve a free VoIP PBX on pbxes.org, and manage diff --git a/metadata/org.sipdroid.sipua/en-US/summary.txt b/metadata/org.sipdroid.sipua/en-US/summary.txt new file mode 100644 index 0000000000..d60379df0e --- /dev/null +++ b/metadata/org.sipdroid.sipua/en-US/summary.txt @@ -0,0 +1 @@ +A SIP (VOIP) client diff --git a/metadata/org.sixgun.ponyexpress.yml b/metadata/org.sixgun.ponyexpress.yml index 75ad7e063f..d949632035 100644 --- a/metadata/org.sixgun.ponyexpress.yml +++ b/metadata/org.sixgun.ponyexpress.yml @@ -3,7 +3,6 @@ Categories: License: GPL-3.0-only AutoName: Pony Express -Summary: SixGun Productions podcasts Description: |- Download and play podcasts from SixGun Productions — producers of the Linux Outlaws podcast. diff --git a/metadata/org.sixgun.ponyexpress/en-US/summary.txt b/metadata/org.sixgun.ponyexpress/en-US/summary.txt new file mode 100644 index 0000000000..aa80e6e104 --- /dev/null +++ b/metadata/org.sixgun.ponyexpress/en-US/summary.txt @@ -0,0 +1 @@ +SixGun Productions podcasts diff --git a/metadata/org.smblott.intentradio.yml b/metadata/org.smblott.intentradio.yml index 34c5be4afc..dbaf8fb0bf 100644 --- a/metadata/org.smblott.intentradio.yml +++ b/metadata/org.smblott.intentradio.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/smblott-github/intent_radio IssueTracker: https://github.com/smblott-github/intent_radio/issues AutoName: IntentRadio -Summary: Intent-driven internet radio player Description: |- Intent Radio is an android internet radio app without a graphical user interface. It is controlled exclusively through the delivery of broadcast diff --git a/metadata/org.smblott.intentradio/en-US/summary.txt b/metadata/org.smblott.intentradio/en-US/summary.txt new file mode 100644 index 0000000000..9e32499bb0 --- /dev/null +++ b/metadata/org.smblott.intentradio/en-US/summary.txt @@ -0,0 +1 @@ +Intent-driven internet radio player diff --git a/metadata/org.smc.inputmethod.indic.yml b/metadata/org.smc.inputmethod.indic.yml index 27fd6d0725..52d6bb7c02 100644 --- a/metadata/org.smc.inputmethod.indic.yml +++ b/metadata/org.smc.inputmethod.indic.yml @@ -6,7 +6,6 @@ SourceCode: https://gitlab.com/indicproject/Indic-Keyboard IssueTracker: https://gitlab.com/indicproject/Indic-Keyboard/issues AutoName: Indic Keyboard -Summary: AOSP Keyboard with Indic language support Description: |- Indic Keyboard is a versatile keyboard for Android users who wish to use Indic and Indian languages to type messages, compose emails and generally prefer to diff --git a/metadata/org.smc.inputmethod.indic/en-US/summary.txt b/metadata/org.smc.inputmethod.indic/en-US/summary.txt new file mode 100644 index 0000000000..e9ef95f167 --- /dev/null +++ b/metadata/org.smc.inputmethod.indic/en-US/summary.txt @@ -0,0 +1 @@ +AOSP Keyboard with Indic language support diff --git a/metadata/org.smerty.zooborns.yml b/metadata/org.smerty.zooborns.yml index c6a281fd08..46c1993ccb 100644 --- a/metadata/org.smerty.zooborns.yml +++ b/metadata/org.smerty.zooborns.yml @@ -4,7 +4,6 @@ License: BSD-3-Clause SourceCode: https://github.com/Smerty/zooborns.android AutoName: ZooBorns -Summary: Watch cute animals Description: |- View the recent photos from [http://zooborns.com zooborns.com], site dedicated to raising awareness of wildlife recreation efforts. Menu key in fullscreen for diff --git a/metadata/org.smerty.zooborns/en-US/summary.txt b/metadata/org.smerty.zooborns/en-US/summary.txt new file mode 100644 index 0000000000..6191c5e1b8 --- /dev/null +++ b/metadata/org.smerty.zooborns/en-US/summary.txt @@ -0,0 +1 @@ +Watch cute animals diff --git a/metadata/org.softcatala.traductor.yml b/metadata/org.softcatala.traductor.yml index 05830307e0..3df03c1e84 100644 --- a/metadata/org.softcatala.traductor.yml +++ b/metadata/org.softcatala.traductor.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/Softcatala/TraductorSoftcatalaAndroid IssueTracker: https://github.com/Softcatala/TraductorSoftcatalaAndroid/issues AutoName: Traductor Softcatalà -Summary: Translate to and from Catalan Description: |- Client for the Softcatalà Catalan on-line [http://www.softcatala.org/traductor translation service]. diff --git a/metadata/org.softcatala.traductor/en-US/summary.txt b/metadata/org.softcatala.traductor/en-US/summary.txt new file mode 100644 index 0000000000..8ba768db6a --- /dev/null +++ b/metadata/org.softcatala.traductor/en-US/summary.txt @@ -0,0 +1 @@ +Translate to and from Catalan diff --git a/metadata/org.softeg.slartus.forpdaplus.yml b/metadata/org.softeg.slartus.forpdaplus.yml index 6aef8c3b6a..82e3cfd376 100644 --- a/metadata/org.softeg.slartus.forpdaplus.yml +++ b/metadata/org.softeg.slartus.forpdaplus.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/slartus/4pdaClient-plus IssueTracker: https://github.com/slartus/4pdaClient-plus/issues AutoName: ForPDA -Summary: Client for 4pda.ru Description: Client companion for the 4pda.ru forum. RepoType: git diff --git a/metadata/org.softeg.slartus.forpdaplus/en-US/summary.txt b/metadata/org.softeg.slartus.forpdaplus/en-US/summary.txt new file mode 100644 index 0000000000..a9e4eada12 --- /dev/null +++ b/metadata/org.softeg.slartus.forpdaplus/en-US/summary.txt @@ -0,0 +1 @@ +Client for 4pda.ru diff --git a/metadata/org.sorz.lab.tinykeepass.yml b/metadata/org.sorz.lab.tinykeepass.yml index f24c363767..802346cadb 100644 --- a/metadata/org.sorz.lab.tinykeepass.yml +++ b/metadata/org.sorz.lab.tinykeepass.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/sorz/TinyKeePass/issues Changelog: https://github.com/sorz/TinyKeePass/releases AutoName: TinyKeePass -Summary: Another simple read-only KeePass app Description: |- Lacks lots of common functions (e.g. edit, groups), and possibly buggy. diff --git a/metadata/org.sorz.lab.tinykeepass/en-US/summary.txt b/metadata/org.sorz.lab.tinykeepass/en-US/summary.txt new file mode 100644 index 0000000000..016ef97656 --- /dev/null +++ b/metadata/org.sorz.lab.tinykeepass/en-US/summary.txt @@ -0,0 +1 @@ +Another simple read-only KeePass app diff --git a/metadata/org.sparkleshare.android.yml b/metadata/org.sparkleshare.android.yml index 8dfe3b7bc9..a90cfd2e60 100644 --- a/metadata/org.sparkleshare.android.yml +++ b/metadata/org.sparkleshare.android.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/NewProggie/SparkleShare-Android IssueTracker: https://github.com/NewProggie/SparkleShare-Android/issues AutoName: SparkleShare -Summary: Distributed collaboration Description: |- SparkleShare is a collaboration and sharing tool that is designed to keep things simple and to stay out of your way. diff --git a/metadata/org.sparkleshare.android/en-US/summary.txt b/metadata/org.sparkleshare.android/en-US/summary.txt new file mode 100644 index 0000000000..d5d40d231f --- /dev/null +++ b/metadata/org.sparkleshare.android/en-US/summary.txt @@ -0,0 +1 @@ +Distributed collaboration diff --git a/metadata/org.strawberryforum.pollywog.yml b/metadata/org.strawberryforum.pollywog.yml index 2a8b6b0b04..ab46326178 100644 --- a/metadata/org.strawberryforum.pollywog.yml +++ b/metadata/org.strawberryforum.pollywog.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/huckleberrypie/pollywog IssueTracker: https://github.com/huckleberrypie/pollywog/issues AutoName: Pollywog -Summary: Minimal utilities menu for the LeapFrog Epic Description: |- Just a minimal utilities menu for the LeapFrog Epic, the purpose being to unlock a number of hidden yet useful options that were present in vanilla AOSP but diff --git a/metadata/org.strawberryforum.pollywog/en-US/summary.txt b/metadata/org.strawberryforum.pollywog/en-US/summary.txt new file mode 100644 index 0000000000..1cb36e4b50 --- /dev/null +++ b/metadata/org.strawberryforum.pollywog/en-US/summary.txt @@ -0,0 +1 @@ +Minimal utilities menu for the LeapFrog Epic diff --git a/metadata/org.subsurface.yml b/metadata/org.subsurface.yml index 9b695b6bc2..958addc6c7 100644 --- a/metadata/org.subsurface.yml +++ b/metadata/org.subsurface.yml @@ -8,7 +8,6 @@ SourceCode: https://github.com/Subsurface-divelog/subsurface IssueTracker: https://github.com/Subsurface-divelog/subsurface/issues AutoName: Subsurface -Summary: Dive logger Description: |- Companion app for the cross-platform Subsurface desktop app diff --git a/metadata/org.subsurface/en-US/summary.txt b/metadata/org.subsurface/en-US/summary.txt new file mode 100644 index 0000000000..6a2d9cd315 --- /dev/null +++ b/metadata/org.subsurface/en-US/summary.txt @@ -0,0 +1 @@ +Dive logger diff --git a/metadata/org.sudowars.yml b/metadata/org.sudowars.yml index 0eaed66005..90cce67722 100644 --- a/metadata/org.sudowars.yml +++ b/metadata/org.sudowars.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/sudowars/sudowars/issues Changelog: https://github.com/sudowars/sudowars#changelog AutoName: Sudowars -Summary: Multiplayer sudoku Description: |- Sudowars is a Sudoku app which enables you to play Sudoku in multiplayer mode over Bluetooth against another person. diff --git a/metadata/org.sudowars/en-US/summary.txt b/metadata/org.sudowars/en-US/summary.txt new file mode 100644 index 0000000000..2b4b8ccdda --- /dev/null +++ b/metadata/org.sudowars/en-US/summary.txt @@ -0,0 +1 @@ +Multiplayer sudoku diff --git a/metadata/org.sufficientlysecure.ical.yml b/metadata/org.sufficientlysecure.ical.yml index d23b0b2f7e..d8c4617f47 100644 --- a/metadata/org.sufficientlysecure.ical.yml +++ b/metadata/org.sufficientlysecure.ical.yml @@ -9,7 +9,6 @@ Donate: https://www.paypal.com/cgi-bin/webscr?cmd=_donations&business=android%40 Bitcoin: 12Y6zbBYoRxf8kBrjau3WedjtzvcACvPMk AutoName: Calendar Import-Export -Summary: Import/Export calendars via ics files Description: |- This app allows you to import/export your calenders using ics files without using Google synchronization services. diff --git a/metadata/org.sufficientlysecure.ical/en-US/summary.txt b/metadata/org.sufficientlysecure.ical/en-US/summary.txt new file mode 100644 index 0000000000..52e4e5f9a0 --- /dev/null +++ b/metadata/org.sufficientlysecure.ical/en-US/summary.txt @@ -0,0 +1 @@ +Import/Export calendars via ics files diff --git a/metadata/org.sufficientlysecure.localcalendar.yml b/metadata/org.sufficientlysecure.localcalendar.yml index 4a459a58ff..057974ab11 100644 --- a/metadata/org.sufficientlysecure.localcalendar.yml +++ b/metadata/org.sufficientlysecure.localcalendar.yml @@ -9,7 +9,6 @@ Donate: https://www.paypal.com/cgi-bin/webscr?cmd=_donations&business=android%40 Bitcoin: 12Y6zbBYoRxf8kBrjau3WedjtzvcACvPMk AutoName: Offline Calendar -Summary: Offline calendar adapter Description: |- Lets you add offline calendars to the Calendar app, which are not synchronized and are accessible only on the device itself. Create the calendar in this app diff --git a/metadata/org.sufficientlysecure.localcalendar/en-US/summary.txt b/metadata/org.sufficientlysecure.localcalendar/en-US/summary.txt new file mode 100644 index 0000000000..f7c47af8ea --- /dev/null +++ b/metadata/org.sufficientlysecure.localcalendar/en-US/summary.txt @@ -0,0 +1 @@ +Offline calendar adapter diff --git a/metadata/org.sufficientlysecure.standalonecalendar.yml b/metadata/org.sufficientlysecure.standalonecalendar.yml index 4ff116199a..51aa3a3447 100644 --- a/metadata/org.sufficientlysecure.standalonecalendar.yml +++ b/metadata/org.sufficientlysecure.standalonecalendar.yml @@ -8,7 +8,6 @@ Donate: https://www.paypal.com/cgi-bin/webscr?cmd=_donations&business=android%40 Bitcoin: 12Y6zbBYoRxf8kBrjau3WedjtzvcACvPMk AutoName: Standalone Calendar -Summary: AOSP calendar Description: |- Note: This project is no longer maintained. For a replacement consider [[ws.xsoh.etar]] or [[com.simplemobiletools.calendar]]. diff --git a/metadata/org.sufficientlysecure.standalonecalendar/en-US/summary.txt b/metadata/org.sufficientlysecure.standalonecalendar/en-US/summary.txt new file mode 100644 index 0000000000..382ba9574a --- /dev/null +++ b/metadata/org.sufficientlysecure.standalonecalendar/en-US/summary.txt @@ -0,0 +1 @@ +AOSP calendar diff --git a/metadata/org.sufficientlysecure.termbot.yml b/metadata/org.sufficientlysecure.termbot.yml index 630c2abe4c..47ca4493fa 100644 --- a/metadata/org.sufficientlysecure.termbot.yml +++ b/metadata/org.sufficientlysecure.termbot.yml @@ -9,7 +9,6 @@ Donate: https://www.paypal.com/cgi-bin/webscr?cmd=_donations&business=android%40 Bitcoin: 1LY6Hs6SurATjfxnihzLMDUMUuMxvQ4aEi AutoName: TermBot -Summary: SSH client for use with smart cards Description: |- Special version of ConnectBot that supports the SSH Authentication API. In combination with OpenKeychain it can use OpenPGP keys. diff --git a/metadata/org.sufficientlysecure.termbot/en-US/summary.txt b/metadata/org.sufficientlysecure.termbot/en-US/summary.txt new file mode 100644 index 0000000000..de0750158d --- /dev/null +++ b/metadata/org.sufficientlysecure.termbot/en-US/summary.txt @@ -0,0 +1 @@ +SSH client for use with smart cards diff --git a/metadata/org.sufficientlysecure.viewer.fontpack.yml b/metadata/org.sufficientlysecure.viewer.fontpack.yml index c7891dd9f2..b23fa57ea0 100644 --- a/metadata/org.sufficientlysecure.viewer.fontpack.yml +++ b/metadata/org.sufficientlysecure.viewer.fontpack.yml @@ -9,7 +9,6 @@ Bitcoin: 12Y6zbBYoRxf8kBrjau3WedjtzvcACvPMk Name: Document Viewer Font Pack AutoName: DV FontPack -Summary: Extra fonts for Document Viewer Description: |- Note: Discontinued. This was a addon for Document Viewer which provided additional fonts. These MuPDF patches to support this no longer apply cleanly, diff --git a/metadata/org.sufficientlysecure.viewer.fontpack/en-US/summary.txt b/metadata/org.sufficientlysecure.viewer.fontpack/en-US/summary.txt new file mode 100644 index 0000000000..dab687f6a4 --- /dev/null +++ b/metadata/org.sufficientlysecure.viewer.fontpack/en-US/summary.txt @@ -0,0 +1 @@ +Extra fonts for Document Viewer diff --git a/metadata/org.sufficientlysecure.viewer.yml b/metadata/org.sufficientlysecure.viewer.yml index 354f63cfee..e76222a9b0 100644 --- a/metadata/org.sufficientlysecure.viewer.yml +++ b/metadata/org.sufficientlysecure.viewer.yml @@ -9,7 +9,6 @@ Donate: https://www.paypal.com/cgi-bin/webscr?cmd=_donations&business=android%40 Bitcoin: 12Y6zbBYoRxf8kBrjau3WedjtzvcACvPMk AutoName: Document Viewer -Summary: Viewer for many document formats Description: |- Document Viewer supports: diff --git a/metadata/org.sufficientlysecure.viewer/en-US/summary.txt b/metadata/org.sufficientlysecure.viewer/en-US/summary.txt new file mode 100644 index 0000000000..e6de00500d --- /dev/null +++ b/metadata/org.sufficientlysecure.viewer/en-US/summary.txt @@ -0,0 +1 @@ +Viewer for many document formats diff --git a/metadata/org.sugr.gearshift.yml b/metadata/org.sugr.gearshift.yml index c4d7d8ed08..0150b6057c 100644 --- a/metadata/org.sugr.gearshift.yml +++ b/metadata/org.sugr.gearshift.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/urandom/gearshift/issues Changelog: https://github.com/urandom/gearshift/releases AutoName: Gear Shift -Summary: Manage Transmission bittorent client Description: |- Remote control for the bittorent client [https://www.transmissionbt.com/ Transmission]. Features include: diff --git a/metadata/org.sugr.gearshift/en-US/summary.txt b/metadata/org.sugr.gearshift/en-US/summary.txt new file mode 100644 index 0000000000..c71c2dba96 --- /dev/null +++ b/metadata/org.sugr.gearshift/en-US/summary.txt @@ -0,0 +1 @@ +Manage Transmission bittorent client diff --git a/metadata/org.supertuxkart.stk.yml b/metadata/org.supertuxkart.stk.yml index 8e7f50b87f..a678800e30 100644 --- a/metadata/org.supertuxkart.stk.yml +++ b/metadata/org.supertuxkart.stk.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/supertuxkart/stk-code IssueTracker: https://github.com/supertuxkart/stk-code/issues Changelog: https://github.com/supertuxkart/stk-code/blob/HEAD/CHANGELOG.md -Summary: Play a kart racing games with Tux and friends Description: Kart racing game, with many tracks, characters and items for you to try. RepoType: git diff --git a/metadata/org.supertuxkart.stk/en-US/summary.txt b/metadata/org.supertuxkart.stk/en-US/summary.txt new file mode 100644 index 0000000000..76ae240090 --- /dev/null +++ b/metadata/org.supertuxkart.stk/en-US/summary.txt @@ -0,0 +1 @@ +Play a kart racing games with Tux and friends diff --git a/metadata/org.surrel.facebooknotifications.yml b/metadata/org.surrel.facebooknotifications.yml index 971315c5d3..c02b3801fa 100644 --- a/metadata/org.surrel.facebooknotifications.yml +++ b/metadata/org.surrel.facebooknotifications.yml @@ -8,7 +8,6 @@ IssueTracker: https://github.com/gsurrel/FacebookNotifications/issues Changelog: https://github.com/gsurrel/FacebookNotifications#changelog AutoName: Notifications for Facebook -Summary: Reproduce the Facebook Notifications in the Android notifications-drawer Description: |- Small Android app for getting notified (friends, messages and notifications) while being privacy-friendly. It doesn't require the Facebook Platform to be diff --git a/metadata/org.surrel.facebooknotifications/en-US/summary.txt b/metadata/org.surrel.facebooknotifications/en-US/summary.txt new file mode 100644 index 0000000000..5aa1c86803 --- /dev/null +++ b/metadata/org.surrel.facebooknotifications/en-US/summary.txt @@ -0,0 +1 @@ +Reproduce the Facebook Notifications in the Android notifications-drawer diff --git a/metadata/org.surrel.messengerbypasser.yml b/metadata/org.surrel.messengerbypasser.yml index ff55905d83..03ca59da2e 100644 --- a/metadata/org.surrel.messengerbypasser.yml +++ b/metadata/org.surrel.messengerbypasser.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/gsurrel/MessengerBypasser/issues Changelog: https://github.com/gsurrel/MessengerBypasser#changelog AutoName: Messenger bypasser -Summary: Redirects "OpenFB Messenger" intents to the web chat Description: |- '''Note:''' This app is discontinued and has been replaced by [[it.rignanese.leo.slimfacebook]]. diff --git a/metadata/org.surrel.messengerbypasser/en-US/summary.txt b/metadata/org.surrel.messengerbypasser/en-US/summary.txt new file mode 100644 index 0000000000..6061e7df98 --- /dev/null +++ b/metadata/org.surrel.messengerbypasser/en-US/summary.txt @@ -0,0 +1 @@ +Redirects "OpenFB Messenger" intents to the web chat diff --git a/metadata/org.synergy.yml b/metadata/org.synergy.yml index 7b3b2a8fa2..93c3f3d794 100644 --- a/metadata/org.synergy.yml +++ b/metadata/org.synergy.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/symless/synergy-cyanogen/issues Changelog: https://github.com/symless/synergy-cyanogen/tree/HEAD/Releases AutoName: Synergy -Summary: Share your screen with multiple devices Description: |- SynergyAndroid is a port of the synergy client to the Android platform. See [http://synergy-project.org] for detail. diff --git a/metadata/org.synergy/en-US/summary.txt b/metadata/org.synergy/en-US/summary.txt new file mode 100644 index 0000000000..b838a1f56a --- /dev/null +++ b/metadata/org.synergy/en-US/summary.txt @@ -0,0 +1 @@ +Share your screen with multiple devices diff --git a/metadata/org.systemcall.scores.yml b/metadata/org.systemcall.scores.yml index 0e3817745d..f1197e5043 100644 --- a/metadata/org.systemcall.scores.yml +++ b/metadata/org.systemcall.scores.yml @@ -3,7 +3,6 @@ Categories: License: GPL-3.0-or-later AutoName: Card Game Scores -Summary: Track game score Description: |- The purpose is to keep scores for games where each turn could give you any (random) score, and not a fixed block; for that type of game, use diff --git a/metadata/org.systemcall.scores/en-US/summary.txt b/metadata/org.systemcall.scores/en-US/summary.txt new file mode 100644 index 0000000000..3184b35548 --- /dev/null +++ b/metadata/org.systemcall.scores/en-US/summary.txt @@ -0,0 +1 @@ +Track game score diff --git a/metadata/org.thiolliere.youtubestream.yml b/metadata/org.thiolliere.youtubestream.yml index 19670295e9..e8a8e24c69 100644 --- a/metadata/org.thiolliere.youtubestream.yml +++ b/metadata/org.thiolliere.youtubestream.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/thiolliere/YouTubeStream IssueTracker: https://github.com/thiolliere/YouTubeStream/issues AutoName: YouTube Stream -Summary: Get YouTube Stream and open it with local application Description: | Share a YouTube video with this application or use the clipboard, the application then get the stream and open it with local application, diff --git a/metadata/org.thiolliere.youtubestream/en-US/summary.txt b/metadata/org.thiolliere.youtubestream/en-US/summary.txt new file mode 100644 index 0000000000..4300535884 --- /dev/null +++ b/metadata/org.thiolliere.youtubestream/en-US/summary.txt @@ -0,0 +1 @@ +Get YouTube Stream and open it with local application diff --git a/metadata/org.torproject.android.yml b/metadata/org.torproject.android.yml index c7664d9047..3f5e7b0b7a 100644 --- a/metadata/org.torproject.android.yml +++ b/metadata/org.torproject.android.yml @@ -12,7 +12,6 @@ LiberapayID: '33617' Bitcoin: 1Fi5xUHiAPRKxHvyUGVFGt9extBe8Srdbk AutoName: Orbot -Summary: Tor (anonymity) client Description: | Tor is both software and an open network that helps you defend against network surveillance that threatens personal freedom and privacy, confidential business diff --git a/metadata/org.torproject.android/en-US/summary.txt b/metadata/org.torproject.android/en-US/summary.txt new file mode 100644 index 0000000000..fa7ef20839 --- /dev/null +++ b/metadata/org.torproject.android/en-US/summary.txt @@ -0,0 +1 @@ +Tor (anonymity) client diff --git a/metadata/org.witness.sscphase1.yml b/metadata/org.witness.sscphase1.yml index 4f9989ddb8..060d716553 100644 --- a/metadata/org.witness.sscphase1.yml +++ b/metadata/org.witness.sscphase1.yml @@ -13,7 +13,6 @@ LiberapayID: '33617' Bitcoin: 1Fi5xUHiAPRKxHvyUGVFGt9extBe8Srdbk AutoName: ObscuraCam -Summary: The Privacy Camera Description: | In a world of viral videos and facial recognition, ObscuraCam helps you share photos and videos while protecting the privacy of you and those you care about. With ObscuraCam you can blur and disguise faces in your photos and videos. Information that could identify you as the cameraperson is removed from the files for added security. diff --git a/metadata/org.witness.sscphase1/en-US/summary.txt b/metadata/org.witness.sscphase1/en-US/summary.txt new file mode 100644 index 0000000000..312ae98d86 --- /dev/null +++ b/metadata/org.witness.sscphase1/en-US/summary.txt @@ -0,0 +1 @@ +The Privacy Camera diff --git a/metadata/org.zephyrsoft.sdbviewer.yml b/metadata/org.zephyrsoft.sdbviewer.yml index 0825da9e22..1e151cff1b 100644 --- a/metadata/org.zephyrsoft.sdbviewer.yml +++ b/metadata/org.zephyrsoft.sdbviewer.yml @@ -8,7 +8,6 @@ IssueTracker: https://github.com/mathisdt/sdbviewer/issues Changelog: https://zephyrsoft.org/sdbviewer/history AutoName: SDB Viewer -Summary: View song lyrics, a translation of it and guitar chords Description: |- This app can display the data produced and managed by [https://zephyrsoft.org/sdb Song Database] if the file is accessible via URL (web address). It cannot be used for anything else, so if you diff --git a/metadata/org.zephyrsoft.sdbviewer/en-US/summary.txt b/metadata/org.zephyrsoft.sdbviewer/en-US/summary.txt new file mode 100644 index 0000000000..b0793b2383 --- /dev/null +++ b/metadata/org.zephyrsoft.sdbviewer/en-US/summary.txt @@ -0,0 +1 @@ +View song lyrics, a translation of it and guitar chords diff --git a/metadata/org.zimmob.zimlx.yml b/metadata/org.zimmob.zimlx.yml index 16bb579d48..f771da9958 100644 --- a/metadata/org.zimmob.zimlx.yml +++ b/metadata/org.zimmob.zimlx.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/otakuhqz/ZimLX/issues Changelog: https://github.com/otakuhqz/ZimLX/releases Donate: https://paypal.me/saulhenriquez -Summary: Powerful launcher with smart features to make your device easy to use Description: |- Open Source and free Launcher for Android based on [[ch.deletescape.lawnchair.plah]] and [[com.benny.openlauncher]]. diff --git a/metadata/org.zimmob.zimlx/en-US/summary.txt b/metadata/org.zimmob.zimlx/en-US/summary.txt new file mode 100644 index 0000000000..48c76161b3 --- /dev/null +++ b/metadata/org.zimmob.zimlx/en-US/summary.txt @@ -0,0 +1 @@ +Powerful launcher with smart features to make your device easy to use diff --git a/metadata/paulscode.android.mupen64plusae.yml b/metadata/paulscode.android.mupen64plusae.yml index f3a6da6d2f..a17ca874ee 100644 --- a/metadata/paulscode.android.mupen64plusae.yml +++ b/metadata/paulscode.android.mupen64plusae.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/paulscode/mupen64plus-ae/issues Changelog: https://github.com/paulscode/mupen64plus-ae/raw/HEAD/assets/changelog.txt AutoName: Mupen64 Plus AE -Summary: Nintendo 64 emulator Description: |- Mupen64Plus AE (Android Edition) is a port of Mupen64Plus to Android (not officially supported by the [http://mupen64plus.org/ Mupen64Plus] team). See diff --git a/metadata/paulscode.android.mupen64plusae/en-US/summary.txt b/metadata/paulscode.android.mupen64plusae/en-US/summary.txt new file mode 100644 index 0000000000..778a07fbb8 --- /dev/null +++ b/metadata/paulscode.android.mupen64plusae/en-US/summary.txt @@ -0,0 +1 @@ +Nintendo 64 emulator diff --git a/metadata/pc.javier.seguime.yml b/metadata/pc.javier.seguime.yml index 5925afd734..8e68f8b43a 100644 --- a/metadata/pc.javier.seguime.yml +++ b/metadata/pc.javier.seguime.yml @@ -8,7 +8,6 @@ IssueTracker: https://gitlab.com/javipc/seguime/issues Donate: https://seguime.000webhostapp.com/ AutoName: Seguime -Summary: Follow where your device goes without being followed by you Description: |- It stores GPS coordinates and sends them to your Web server so you can see where is the device. diff --git a/metadata/pc.javier.seguime/en-US/summary.txt b/metadata/pc.javier.seguime/en-US/summary.txt index 46122f819b..64c944594f 100644 --- a/metadata/pc.javier.seguime/en-US/summary.txt +++ b/metadata/pc.javier.seguime/en-US/summary.txt @@ -1 +1 @@ -Follow where your device goes without being followed by you \ No newline at end of file +Follow where your device goes without being followed by you diff --git a/metadata/peanutencryption.peanutencryption.yml b/metadata/peanutencryption.peanutencryption.yml index b00c861fdb..c625f74815 100644 --- a/metadata/peanutencryption.peanutencryption.yml +++ b/metadata/peanutencryption.peanutencryption.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/goexle/peanutEncryption IssueTracker: https://github.com/goexle/peanutEncryption/issues AutoName: Peanut Encryption -Summary: Encrypt and store passwords Description: |- Store your codes and passwords encrypted on your device. You need your master password each time you want to access your saved codes/passwords. diff --git a/metadata/peanutencryption.peanutencryption/en-US/summary.txt b/metadata/peanutencryption.peanutencryption/en-US/summary.txt new file mode 100644 index 0000000000..4cfa784ce7 --- /dev/null +++ b/metadata/peanutencryption.peanutencryption/en-US/summary.txt @@ -0,0 +1 @@ +Encrypt and store passwords diff --git a/metadata/pk.contender.earmouse.yml b/metadata/pk.contender.earmouse.yml index af6b2028e6..5663c3b02e 100644 --- a/metadata/pk.contender.earmouse.yml +++ b/metadata/pk.contender.earmouse.yml @@ -8,7 +8,6 @@ IssueTracker: https://gitlab.com/pklinken/earmouse/issues Bitcoin: 1FdwmPaKhE6pmPRxNHcWh3yFDo3mdtMPy AutoName: Earmouse -Summary: Improve your musical ear Description: |- Learn to tell apart different musical intervals and chords through one of the many available modules. Earmouse comes with 10 modules pre-installed to get you diff --git a/metadata/pk.contender.earmouse/en-US/summary.txt b/metadata/pk.contender.earmouse/en-US/summary.txt new file mode 100644 index 0000000000..d2ef30e218 --- /dev/null +++ b/metadata/pk.contender.earmouse/en-US/summary.txt @@ -0,0 +1 @@ +Improve your musical ear diff --git a/metadata/pl.hypeapp.endoscope.yml b/metadata/pl.hypeapp.endoscope.yml index fcac1264d2..ba2a7912b3 100644 --- a/metadata/pl.hypeapp.endoscope.yml +++ b/metadata/pl.hypeapp.endoscope.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/hypeapps/Endoscope IssueTracker: https://github.com/hypeapps/Endoscope/issues AutoName: Endoscope -Summary: RTSP live video streamer via Wi-Fi Description: |- Endoscope allows you to fast link two android devices and stream a live video of the camera of one device to the other. Video stream is over Wi-Fi. One device diff --git a/metadata/pl.hypeapp.endoscope/en-US/summary.txt b/metadata/pl.hypeapp.endoscope/en-US/summary.txt new file mode 100644 index 0000000000..5aa7b3bfc0 --- /dev/null +++ b/metadata/pl.hypeapp.endoscope/en-US/summary.txt @@ -0,0 +1 @@ +RTSP live video streamer via Wi-Fi diff --git a/metadata/pl.hypeapp.episodie.yml b/metadata/pl.hypeapp.episodie.yml index 4ac42d81c0..c70585720a 100644 --- a/metadata/pl.hypeapp.episodie.yml +++ b/metadata/pl.hypeapp.episodie.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/hypeapps/episodie IssueTracker: https://github.com/hypeapps/episodie/issues AutoName: Episodie -Summary: Discover and track TV show time Description: |- Episodie is a TV show time tracker app with unusual design. Get to know how much time you spent watching tv shows. Track easily overall progress of your favorite diff --git a/metadata/pl.hypeapp.episodie/en-US/summary.txt b/metadata/pl.hypeapp.episodie/en-US/summary.txt new file mode 100644 index 0000000000..e35eaabdd2 --- /dev/null +++ b/metadata/pl.hypeapp.episodie/en-US/summary.txt @@ -0,0 +1 @@ +Discover and track TV show time diff --git a/metadata/pl.kuben.progressapp.yml b/metadata/pl.kuben.progressapp.yml index 8afebf2330..dcdba2b803 100644 --- a/metadata/pl.kuben.progressapp.yml +++ b/metadata/pl.kuben.progressapp.yml @@ -9,7 +9,6 @@ IssueTracker: https://gitlab.com/JakubNeukirch/progress-tracker/issues Donate: https://www.paypal.me/JakubNeukirch AutoName: Progress Tracker -Summary: Any activity progress tracker Description: |- The progress tracking app you needed to improve your regularity and achieve success. This app lets you track: diff --git a/metadata/pl.kuben.progressapp/en-US/summary.txt b/metadata/pl.kuben.progressapp/en-US/summary.txt new file mode 100644 index 0000000000..a00f6b0550 --- /dev/null +++ b/metadata/pl.kuben.progressapp/en-US/summary.txt @@ -0,0 +1 @@ +Any activity progress tracker diff --git a/metadata/pl.narfsoftware.thermometer.yml b/metadata/pl.narfsoftware.thermometer.yml index 4c47878b60..28f799bc05 100644 --- a/metadata/pl.narfsoftware.thermometer.yml +++ b/metadata/pl.narfsoftware.thermometer.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/mateuszbuda/ThermometerExtended2 IssueTracker: https://github.com/mateuszbuda/ThermometerExtended2/issues AutoName: Thermometer Extended -Summary: Ambient conditions with charts Description: |- It displays additional information about various ambient conditions. You can also choose to save data and examine it on a plot. diff --git a/metadata/pl.narfsoftware.thermometer/en-US/summary.txt b/metadata/pl.narfsoftware.thermometer/en-US/summary.txt new file mode 100644 index 0000000000..325e60436a --- /dev/null +++ b/metadata/pl.narfsoftware.thermometer/en-US/summary.txt @@ -0,0 +1 @@ +Ambient conditions with charts diff --git a/metadata/pl.net.szafraniec.NFCKey.yml b/metadata/pl.net.szafraniec.NFCKey.yml index 27686b9f29..f044511c4b 100644 --- a/metadata/pl.net.szafraniec.NFCKey.yml +++ b/metadata/pl.net.szafraniec.NFCKey.yml @@ -8,7 +8,6 @@ Donate: https://www.paypal.com/cgi-bin/webscr?cmd=_s-xclick&hosted_button_id=XBH Bitcoin: 17E32x5ygXkqf5EWJkryZuarUDUFrb8UqQ AutoName: NFC Key -Summary: Unlock KeePass database with NFC Description: |- Unlock KeePass database with any NFC tags such as: diff --git a/metadata/pl.net.szafraniec.NFCKey/en-US/summary.txt b/metadata/pl.net.szafraniec.NFCKey/en-US/summary.txt new file mode 100644 index 0000000000..6a85125905 --- /dev/null +++ b/metadata/pl.net.szafraniec.NFCKey/en-US/summary.txt @@ -0,0 +1 @@ +Unlock KeePass database with NFC diff --git a/metadata/pl.net.szafraniec.NFCTagmaker.yml b/metadata/pl.net.szafraniec.NFCTagmaker.yml index ce6582d083..0bbe252dd2 100644 --- a/metadata/pl.net.szafraniec.NFCTagmaker.yml +++ b/metadata/pl.net.szafraniec.NFCTagmaker.yml @@ -8,7 +8,6 @@ Donate: https://www.paypal.com/cgi-bin/webscr?cmd=_s-xclick&hosted_button_id=XBH Bitcoin: 17E32x5ygXkqf5EWJkryZuarUDUFrb8UqQ AutoName: NFC Tag maker -Summary: Make NFC Smart posters Description: |- '''Note:''' This app is no longer maintained. diff --git a/metadata/pl.net.szafraniec.NFCTagmaker/en-US/summary.txt b/metadata/pl.net.szafraniec.NFCTagmaker/en-US/summary.txt new file mode 100644 index 0000000000..50be36d982 --- /dev/null +++ b/metadata/pl.net.szafraniec.NFCTagmaker/en-US/summary.txt @@ -0,0 +1 @@ +Make NFC Smart posters diff --git a/metadata/pl.nkg.geokrety.yml b/metadata/pl.nkg.geokrety.yml index c835812cbc..cf9952985f 100644 --- a/metadata/pl.nkg.geokrety.yml +++ b/metadata/pl.nkg.geokrety.yml @@ -6,7 +6,6 @@ SourceCode: https://sourceforge.net/p/geokretylog/code IssueTracker: https://forum.opencaching.pl/viewtopic.php?f=6&t=7789 AutoName: GeoKrety Logger -Summary: Geocaching client Description: |- GeoKrety is a non-commercial GeoCaching game. People move registered objects (called GeoKrety) from cache to cache and register each move with the service. diff --git a/metadata/pl.nkg.geokrety/en-US/summary.txt b/metadata/pl.nkg.geokrety/en-US/summary.txt new file mode 100644 index 0000000000..0e3871b95f --- /dev/null +++ b/metadata/pl.nkg.geokrety/en-US/summary.txt @@ -0,0 +1 @@ +Geocaching client diff --git a/metadata/pl.sanszo.pcis.yml b/metadata/pl.sanszo.pcis.yml index ad47ee92af..7d19e3865e 100644 --- a/metadata/pl.sanszo.pcis.yml +++ b/metadata/pl.sanszo.pcis.yml @@ -10,7 +10,6 @@ Bitcoin: 1PbH84rewi34Ffgr3C5NutMdvEzSQ13wUt Litecoin: LhKMBgcUHQagnCcaxSaWCCXztbTMMBPvu5 AutoName: Poland can into Space -Summary: Help Polandball to get into Space Description: | Poland can into Space is a simple Android game based on LibGDX framework. The game uses also the Box2D Physics Engine. In the game, player takes control of Polandball and helps him to reach high altitude and gives him opportunity to GET INTO SPACE! diff --git a/metadata/player.efis.data.eur.rus.yml b/metadata/player.efis.data.eur.rus.yml index 6d7354e22b..fcb5816ddd 100644 --- a/metadata/player.efis.data.eur.rus.yml +++ b/metadata/player.efis.data.eur.rus.yml @@ -8,7 +8,6 @@ Changelog: https://github.com/ninelima/kwikEFIS/blob/HEAD/CHANGELOG.md Bitcoin: 1KKWRF25NwVgNdankr1vBphtkLbX766Ee1 AutoName: Kwik DataPac (eur.rus) -Summary: Electronic Flight Information System (EFIS) Terrain Data Description: |- The synthetic vision terrain (DEM) data pack for use with [https://f-droid.org/packages/player.efis.pfd/ Kwik EFIS] and diff --git a/metadata/player.efis.data.eur.rus/en-US/summary.txt b/metadata/player.efis.data.eur.rus/en-US/summary.txt new file mode 100644 index 0000000000..6711c754c9 --- /dev/null +++ b/metadata/player.efis.data.eur.rus/en-US/summary.txt @@ -0,0 +1 @@ +Electronic Flight Information System (EFIS) Terrain Data diff --git a/metadata/player.efis.data.pan.arg.yml b/metadata/player.efis.data.pan.arg.yml index a1836422ea..7bf1b99e5a 100644 --- a/metadata/player.efis.data.pan.arg.yml +++ b/metadata/player.efis.data.pan.arg.yml @@ -8,7 +8,6 @@ Changelog: https://github.com/ninelima/kwikEFIS/blob/HEAD/CHANGELOG.md Bitcoin: 1KKWRF25NwVgNdankr1vBphtkLbX766Ee1 AutoName: Kwik DataPac (pan.arg) -Summary: Electronic Flight Information System (EFIS) Terrain Data Description: |- The synthetic vision terrain (DEM) data pack for use with [https://f-droid.org/packages/player.efis.pfd/ Kwik EFIS] and diff --git a/metadata/player.efis.data.pan.arg/en-US/summary.txt b/metadata/player.efis.data.pan.arg/en-US/summary.txt new file mode 100644 index 0000000000..6711c754c9 --- /dev/null +++ b/metadata/player.efis.data.pan.arg/en-US/summary.txt @@ -0,0 +1 @@ +Electronic Flight Information System (EFIS) Terrain Data diff --git a/metadata/player.efis.data.sah.jap.yml b/metadata/player.efis.data.sah.jap.yml index 7c8e5e2556..ee89016e59 100644 --- a/metadata/player.efis.data.sah.jap.yml +++ b/metadata/player.efis.data.sah.jap.yml @@ -8,7 +8,6 @@ Changelog: https://github.com/ninelima/kwikEFIS/blob/HEAD/CHANGELOG.md Bitcoin: 1KKWRF25NwVgNdankr1vBphtkLbX766Ee1 AutoName: Kwik DataPac (sah.jap) -Summary: Electronic Flight Information System (EFIS) Terrain Data Description: |- The synthetic vision terrain (DEM) data pack for use with [https://f-droid.org/packages/player.efis.pfd/ Kwik EFIS] and diff --git a/metadata/player.efis.data.sah.jap/en-US/summary.txt b/metadata/player.efis.data.sah.jap/en-US/summary.txt new file mode 100644 index 0000000000..6711c754c9 --- /dev/null +++ b/metadata/player.efis.data.sah.jap/en-US/summary.txt @@ -0,0 +1 @@ +Electronic Flight Information System (EFIS) Terrain Data diff --git a/metadata/player.efis.data.usa.can.yml b/metadata/player.efis.data.usa.can.yml index bfdf7e387c..7b625585bb 100644 --- a/metadata/player.efis.data.usa.can.yml +++ b/metadata/player.efis.data.usa.can.yml @@ -8,7 +8,6 @@ Changelog: https://github.com/ninelima/kwikEFIS/blob/HEAD/CHANGELOG.md Bitcoin: 1KKWRF25NwVgNdankr1vBphtkLbX766Ee1 AutoName: Kwik DataPac (usa.can) -Summary: Electronic Flight Information System (EFIS) Terrain Data Description: |- The synthetic vision terrain (DEM) data pack for use with [https://f-droid.org/packages/player.efis.pfd/ Kwik EFIS] and diff --git a/metadata/player.efis.data.usa.can/en-US/summary.txt b/metadata/player.efis.data.usa.can/en-US/summary.txt new file mode 100644 index 0000000000..6711c754c9 --- /dev/null +++ b/metadata/player.efis.data.usa.can/en-US/summary.txt @@ -0,0 +1 @@ +Electronic Flight Information System (EFIS) Terrain Data diff --git a/metadata/player.efis.data.zar.aus.yml b/metadata/player.efis.data.zar.aus.yml index 8f2d0677fd..4991cf6d5f 100644 --- a/metadata/player.efis.data.zar.aus.yml +++ b/metadata/player.efis.data.zar.aus.yml @@ -8,7 +8,6 @@ Changelog: https://github.com/ninelima/kwikEFIS/blob/HEAD/CHANGELOG.md Bitcoin: 1KKWRF25NwVgNdankr1vBphtkLbX766Ee1 AutoName: Kwik DataPac (zar.aus) -Summary: Electronic Flight Information System (EFIS) Terrain Data Description: |- The synthetic vision terrain (DEM) data pack for use with [https://f-droid.org/packages/player.efis.pfd/ Kwik EFIS] and diff --git a/metadata/player.efis.data.zar.aus/en-US/summary.txt b/metadata/player.efis.data.zar.aus/en-US/summary.txt new file mode 100644 index 0000000000..6711c754c9 --- /dev/null +++ b/metadata/player.efis.data.zar.aus/en-US/summary.txt @@ -0,0 +1 @@ +Electronic Flight Information System (EFIS) Terrain Data diff --git a/metadata/player.efis.mfd.yml b/metadata/player.efis.mfd.yml index 6e061b79fd..51f8289b13 100644 --- a/metadata/player.efis.mfd.yml +++ b/metadata/player.efis.mfd.yml @@ -8,7 +8,6 @@ Changelog: https://gitlab.com/ninelima/kwikEFIS/blob/HEAD/CHANGELOG.md Bitcoin: 1KKWRF25NwVgNdankr1vBphtkLbX766Ee1 AutoName: Kwik DMAP -Summary: Electronic Flight Information System (DMAP) Description: |- Kwik Moving Map is a companion application to the EFIS. It provides situational awareness and and navigation functionality. diff --git a/metadata/player.efis.mfd/en-US/summary.txt b/metadata/player.efis.mfd/en-US/summary.txt new file mode 100644 index 0000000000..e696f00832 --- /dev/null +++ b/metadata/player.efis.mfd/en-US/summary.txt @@ -0,0 +1 @@ +Electronic Flight Information System (DMAP) diff --git a/metadata/player.efis.pfd.yml b/metadata/player.efis.pfd.yml index 0df3f28ed4..6b5ae19221 100644 --- a/metadata/player.efis.pfd.yml +++ b/metadata/player.efis.pfd.yml @@ -8,7 +8,6 @@ Changelog: https://gitlab.com/ninelima/kwikEFIS/blob/HEAD/CHANGELOG.md Bitcoin: 1KKWRF25NwVgNdankr1vBphtkLbX766Ee1 AutoName: Kwik EFIS -Summary: Electronic Flight Information System (EFIS) Description: |- Kwik EFIS is a Glass Cockpit application designed to work on most Android devices equipped with a GPS, gyroscope, accelerometer and a CPU with reasonable diff --git a/metadata/player.efis.pfd/en-US/summary.txt b/metadata/player.efis.pfd/en-US/summary.txt new file mode 100644 index 0000000000..7eadd75b41 --- /dev/null +++ b/metadata/player.efis.pfd/en-US/summary.txt @@ -0,0 +1 @@ +Electronic Flight Information System (EFIS) diff --git a/metadata/press.condense.www.yml b/metadata/press.condense.www.yml index afac395790..6a6c613828 100644 --- a/metadata/press.condense.www.yml +++ b/metadata/press.condense.www.yml @@ -7,7 +7,6 @@ Donate: https://www.paypal.me/agnelv Bitcoin: 325oe18pc8npqHeBGozobnvWfXXe3pujXq AutoName: News -Summary: A news recommendation engine with user customizable parameters Description: |- News apps like Google News, Flipboard, BBC show trending articles written a day or two back. If say there are hundred articles written in a day, these news diff --git a/metadata/press.condense.www/en-US/summary.txt b/metadata/press.condense.www/en-US/summary.txt new file mode 100644 index 0000000000..9fb80ff0c8 --- /dev/null +++ b/metadata/press.condense.www/en-US/summary.txt @@ -0,0 +1 @@ +A news recommendation engine with user customizable parameters diff --git a/metadata/priv.twoerner.brightnesswidget.yml b/metadata/priv.twoerner.brightnesswidget.yml index f1719c94fe..e4ae263e85 100644 --- a/metadata/priv.twoerner.brightnesswidget.yml +++ b/metadata/priv.twoerner.brightnesswidget.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/tillwoerner/BrightnessWidget IssueTracker: https://github.com/tillwoerner/BrightnessWidget/issues AutoName: Brightness Widget -Summary: Change brightness on the homescreen Description: Configurable brightness widget. RepoType: git diff --git a/metadata/priv.twoerner.brightnesswidget/en-US/summary.txt b/metadata/priv.twoerner.brightnesswidget/en-US/summary.txt new file mode 100644 index 0000000000..9a14be6da7 --- /dev/null +++ b/metadata/priv.twoerner.brightnesswidget/en-US/summary.txt @@ -0,0 +1 @@ +Change brightness on the homescreen diff --git a/metadata/privacyfriendlyshoppinglist.secuso.org.privacyfriendlyshoppinglist.yml b/metadata/privacyfriendlyshoppinglist.secuso.org.privacyfriendlyshoppinglist.yml index 7f628f9d39..6cd55abe92 100644 --- a/metadata/privacyfriendlyshoppinglist.secuso.org.privacyfriendlyshoppinglist.yml +++ b/metadata/privacyfriendlyshoppinglist.secuso.org.privacyfriendlyshoppinglist.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/SecUSo/privacy-friendly-shopping-list/issues Changelog: https://github.com/SecUSo/privacy-friendly-shopping-list/blob/HEAD/CHANGELOG.md AutoName: Shopping List -Summary: Create and manage shopping lists Description: |- Create shopping lists and manage them by adding, editing and deleting of lists and items. diff --git a/metadata/privacyfriendlyshoppinglist.secuso.org.privacyfriendlyshoppinglist/en-US/summary.txt b/metadata/privacyfriendlyshoppinglist.secuso.org.privacyfriendlyshoppinglist/en-US/summary.txt new file mode 100644 index 0000000000..2b465260af --- /dev/null +++ b/metadata/privacyfriendlyshoppinglist.secuso.org.privacyfriendlyshoppinglist/en-US/summary.txt @@ -0,0 +1 @@ +Create and manage shopping lists diff --git a/metadata/pro.dbro.bart.yml b/metadata/pro.dbro.bart.yml index 0fad09946e..e6a5e86f79 100644 --- a/metadata/pro.dbro.bart.yml +++ b/metadata/pro.dbro.bart.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/OnlyInAmerica/BART IssueTracker: https://github.com/OnlyInAmerica/BART/issues AutoName: Open BART -Summary: Navigate U.S. railways Description: |- Companion to San Francisco’s BART. It provides real-time station arrivals, schedules, and route navigation. diff --git a/metadata/pro.dbro.bart/en-US/summary.txt b/metadata/pro.dbro.bart/en-US/summary.txt new file mode 100644 index 0000000000..fc9856f2af --- /dev/null +++ b/metadata/pro.dbro.bart/en-US/summary.txt @@ -0,0 +1 @@ +Navigate U.S. railways diff --git a/metadata/pro.oneredpixel.l9droid.yml b/metadata/pro.oneredpixel.l9droid.yml index ff92d7c158..297c17789e 100644 --- a/metadata/pro.oneredpixel.l9droid.yml +++ b/metadata/pro.oneredpixel.l9droid.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/tsapree/L9Droid/issues Changelog: https://github.com/tsapree/L9Droid/releases AutoName: L9Droid -Summary: Interactive fiction Description: Download and play games in the Level9 format, including Spectrum snapshots. RepoType: git diff --git a/metadata/pro.oneredpixel.l9droid/en-US/summary.txt b/metadata/pro.oneredpixel.l9droid/en-US/summary.txt new file mode 100644 index 0000000000..d3f21fcfdd --- /dev/null +++ b/metadata/pro.oneredpixel.l9droid/en-US/summary.txt @@ -0,0 +1 @@ +Interactive fiction diff --git a/metadata/pro.rudloff.openvegemap.yml b/metadata/pro.rudloff.openvegemap.yml index 45e2d94e90..7d20887e42 100644 --- a/metadata/pro.rudloff.openvegemap.yml +++ b/metadata/pro.rudloff.openvegemap.yml @@ -9,7 +9,6 @@ Changelog: https://github.com/Rudloff/openvegemap-cordova/releases LiberapayID: '34455' AutoName: OpenVegeMap -Summary: Find vegetarian and vegan restaurants in your city Description: |- This app allows you to find vegetarian and vegan restaurants near you. It is based on data from OpenStreetmap. diff --git a/metadata/pro.rudloff.openvegemap/en-US/summary.txt b/metadata/pro.rudloff.openvegemap/en-US/summary.txt new file mode 100644 index 0000000000..6d3bba92d4 --- /dev/null +++ b/metadata/pro.rudloff.openvegemap/en-US/summary.txt @@ -0,0 +1 @@ +Find vegetarian and vegan restaurants in your city diff --git a/metadata/pro.rudloff.papercraft.yml b/metadata/pro.rudloff.papercraft.yml index 493ce3ee67..cd2475179e 100644 --- a/metadata/pro.rudloff.papercraft.yml +++ b/metadata/pro.rudloff.papercraft.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/Rudloff/PaperCraft IssueTracker: https://github.com/Rudloff/PaperCraft/issues AutoName: PaperCraft -Summary: A Material Design inspired space shooter Description: |- Take on a never ending onslaught of little paper bad guys. Swipe and tap to clear out everything and rack up points. PaperCraft is a mini space battle on diff --git a/metadata/pro.rudloff.papercraft/en-US/summary.txt b/metadata/pro.rudloff.papercraft/en-US/summary.txt new file mode 100644 index 0000000000..95cbcd4963 --- /dev/null +++ b/metadata/pro.rudloff.papercraft/en-US/summary.txt @@ -0,0 +1 @@ +A Material Design inspired space shooter diff --git a/metadata/protect.babymonitor.yml b/metadata/protect.babymonitor.yml index d098f68301..8c4ca3b2d5 100644 --- a/metadata/protect.babymonitor.yml +++ b/metadata/protect.babymonitor.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/brarcher/protect-baby-monitor/issues Changelog: https://raw.githubusercontent.com/brarcher/protect-baby-monitor/HEAD/NEWS AutoName: Protect Baby Monitor -Summary: Baby Monitor Description: |- Protect Baby Monitor allows two Android devices to act as a baby monitor. The first device, left in the room with the baby, will advertise itself on the diff --git a/metadata/protect.babymonitor/en-US/summary.txt b/metadata/protect.babymonitor/en-US/summary.txt new file mode 100644 index 0000000000..06d046375f --- /dev/null +++ b/metadata/protect.babymonitor/en-US/summary.txt @@ -0,0 +1 @@ +Baby Monitor diff --git a/metadata/protect.babysleepsounds.yml b/metadata/protect.babysleepsounds.yml index 7ec4147b41..38bae6f9e5 100644 --- a/metadata/protect.babysleepsounds.yml +++ b/metadata/protect.babysleepsounds.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/brarcher/baby-sleep-sounds/issues Changelog: https://github.com/brarcher/baby-sleep-sounds/releases AutoName: Baby Sleep Sounds -Summary: Play sounds to help babies sleep Description: Baby Sleep Sounds will play a variety of sounds to help a baby sleep soundly. diff --git a/metadata/protect.babysleepsounds/en-US/summary.txt b/metadata/protect.babysleepsounds/en-US/summary.txt new file mode 100644 index 0000000000..9fd51dcba8 --- /dev/null +++ b/metadata/protect.babysleepsounds/en-US/summary.txt @@ -0,0 +1 @@ +Play sounds to help babies sleep diff --git a/metadata/protect.budgetwatch.yml b/metadata/protect.budgetwatch.yml index 623ff7cfb8..6a290d5a49 100644 --- a/metadata/protect.budgetwatch.yml +++ b/metadata/protect.budgetwatch.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/brarcher/budget-watch/issues Changelog: https://github.com/brarcher/budget-watch/releases AutoName: Budget Watch -Summary: Help manage your personal budget Description: |- Budget Watch helps manage personal budgets. After adding your budgets, simply record your day-to-day transactions. You can then view how close your spending diff --git a/metadata/protect.budgetwatch/en-US/summary.txt b/metadata/protect.budgetwatch/en-US/summary.txt new file mode 100644 index 0000000000..f6ea4a63a8 --- /dev/null +++ b/metadata/protect.budgetwatch/en-US/summary.txt @@ -0,0 +1 @@ +Help manage your personal budget diff --git a/metadata/protect.card_locker.yml b/metadata/protect.card_locker.yml index e27e2dd394..8d62ec22ec 100644 --- a/metadata/protect.card_locker.yml +++ b/metadata/protect.card_locker.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/brarcher/loyalty-card-locker/issues Changelog: https://github.com/brarcher/loyalty-card-locker/blob/HEAD/CHANGELOG.md AutoName: Loyalty Card Keychain -Summary: Manages barcode-based store/loyalty cards on your phone Description: |- Manages barcode-based store/loyalty cards on your phone, removing the need to carry them around. diff --git a/metadata/protect.card_locker/en-US/summary.txt b/metadata/protect.card_locker/en-US/summary.txt new file mode 100644 index 0000000000..479bbea97a --- /dev/null +++ b/metadata/protect.card_locker/en-US/summary.txt @@ -0,0 +1 @@ +Manages barcode-based store/loyalty cards on your phone diff --git a/metadata/protect.gift_card_guard.yml b/metadata/protect.gift_card_guard.yml index d82fa812f0..9956a5e23e 100644 --- a/metadata/protect.gift_card_guard.yml +++ b/metadata/protect.gift_card_guard.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/brarcher/gift-card-guard/issues Changelog: https://github.com/brarcher/gift-card-guard/releases AutoName: Gift Card Guard -Summary: Manage gift cards and their current values Description: |- Manage gift cards, their current values, and an image of the most recent receipt. Never forget how much a gift card is worth, or be unable to use a gift diff --git a/metadata/protect.gift_card_guard/en-US/summary.txt b/metadata/protect.gift_card_guard/en-US/summary.txt new file mode 100644 index 0000000000..bab1240a9a --- /dev/null +++ b/metadata/protect.gift_card_guard/en-US/summary.txt @@ -0,0 +1 @@ +Manage gift cards and their current values diff --git a/metadata/protect.rentalcalc.yml b/metadata/protect.rentalcalc.yml index f844057cfd..97909ed396 100644 --- a/metadata/protect.rentalcalc.yml +++ b/metadata/protect.rentalcalc.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/brarcher/rental-calc/issues Changelog: https://github.com/brarcher/rental-calc/releases AutoName: Rental Calc -Summary: Evaluate rental property investment prospects Description: |- Are you interested in investing in real estate and want to rent out homes? Not sure how to determine if a property is a good investment? diff --git a/metadata/protect.rentalcalc/en-US/summary.txt b/metadata/protect.rentalcalc/en-US/summary.txt new file mode 100644 index 0000000000..7e1339bfa9 --- /dev/null +++ b/metadata/protect.rentalcalc/en-US/summary.txt @@ -0,0 +1 @@ +Evaluate rental property investment prospects diff --git a/metadata/protect.videoeditor.yml b/metadata/protect.videoeditor.yml index 4f66f3a627..7b31525096 100644 --- a/metadata/protect.videoeditor.yml +++ b/metadata/protect.videoeditor.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/brarcher/video-transcoder/issues Changelog: https://github.com/brarcher/video-transcoder/releases AutoName: Video Transcoder -Summary: Video transcoding between common formats Description: |- Do you want to encode videos on your phone into different formats, trim videos, or extract audio? Are you looking for a free solution which will not take your diff --git a/metadata/protect.videoeditor/en-US/summary.txt b/metadata/protect.videoeditor/en-US/summary.txt new file mode 100644 index 0000000000..e4a63f4e89 --- /dev/null +++ b/metadata/protect.videoeditor/en-US/summary.txt @@ -0,0 +1 @@ +Video transcoding between common formats diff --git a/metadata/pt.ipleiria.mymusicqoe.yml b/metadata/pt.ipleiria.mymusicqoe.yml index 8ac89953b0..de1083b74b 100644 --- a/metadata/pt.ipleiria.mymusicqoe.yml +++ b/metadata/pt.ipleiria.mymusicqoe.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/albertolalanda/new-ultrasonic-fork-for-MyMusicQ Changelog: https://github.com/albertolalanda/new-ultrasonic-fork-for-MyMusicQoE/releases AutoName: MyMusicQoE -Summary: A fork of ultrasonic with QoE evaluation features purposes Description: |- The purpose of MyMusicQoE is to gather statistics of music streaming quality of experience. This application was based on Ultrasonic and uses an airsonic diff --git a/metadata/pt.ipleiria.mymusicqoe/en-US/summary.txt b/metadata/pt.ipleiria.mymusicqoe/en-US/summary.txt new file mode 100644 index 0000000000..823f736286 --- /dev/null +++ b/metadata/pt.ipleiria.mymusicqoe/en-US/summary.txt @@ -0,0 +1 @@ +A fork of ultrasonic with QoE evaluation features purposes diff --git a/metadata/pt.isec.tp.am.yml b/metadata/pt.isec.tp.am.yml index 7f7f2f1ec1..b5fafb4858 100644 --- a/metadata/pt.isec.tp.am.yml +++ b/metadata/pt.isec.tp.am.yml @@ -3,7 +3,6 @@ Categories: License: GPL-3.0-only AutoName: Free Fall -Summary: Accelerometer-based game Description: |- Save the CrazyBall from getting crushed at the top of the screen by dodging the moving barriers using the accelerometer. To help you along the way some special diff --git a/metadata/pt.isec.tp.am/en-US/summary.txt b/metadata/pt.isec.tp.am/en-US/summary.txt new file mode 100644 index 0000000000..c7221d7142 --- /dev/null +++ b/metadata/pt.isec.tp.am/en-US/summary.txt @@ -0,0 +1 @@ +Accelerometer-based game diff --git a/metadata/pt.joaomneto.titancompanion.yml b/metadata/pt.joaomneto.titancompanion.yml index 35d8620735..ae7fed7fd6 100644 --- a/metadata/pt.joaomneto.titancompanion.yml +++ b/metadata/pt.joaomneto.titancompanion.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/joaomneto/TitanCompanion/issues Changelog: https://github.com/joaomneto/TitanCompanion/releases AutoName: Titan Companion -Summary: Stat sheet and rules engine for all Fighting Fantasy gamebooks Description: |- The main objective of this app is to allow the reader to fully immerse himself into the story and even to give some portability to the gamebooks. You can read diff --git a/metadata/pt.joaomneto.titancompanion/en-US/summary.txt b/metadata/pt.joaomneto.titancompanion/en-US/summary.txt new file mode 100644 index 0000000000..a5aa9e0c09 --- /dev/null +++ b/metadata/pt.joaomneto.titancompanion/en-US/summary.txt @@ -0,0 +1 @@ +Stat sheet and rules engine for all Fighting Fantasy gamebooks diff --git a/metadata/pw.thedrhax.mosmetro.yml b/metadata/pw.thedrhax.mosmetro.yml index 09c9fa380e..1e9ba6c2ed 100644 --- a/metadata/pw.thedrhax.mosmetro.yml +++ b/metadata/pw.thedrhax.mosmetro.yml @@ -9,7 +9,6 @@ IssueTracker: https://github.com/mosmetro-android/mosmetro-android/issues Changelog: https://github.com/mosmetro-android/mosmetro-android/blob/HEAD/CHANGELOG AutoName: Moscow Wi-Fi autologin -Summary: Automatically connect to public networks of Moscow public transport Description: |- Allows you to connect to Wi-Fi in the Moscow metro, Aeroexpress, MCC and other ground transportation (buses, trolleybuses, trams) in fully automatic mode. No diff --git a/metadata/pw.thedrhax.mosmetro/en-US/summary.txt b/metadata/pw.thedrhax.mosmetro/en-US/summary.txt new file mode 100644 index 0000000000..097b292c47 --- /dev/null +++ b/metadata/pw.thedrhax.mosmetro/en-US/summary.txt @@ -0,0 +1 @@ +Automatically connect to public networks of Moscow public transport diff --git a/metadata/raele.concurseiro.yml b/metadata/raele.concurseiro.yml index 630c3326e6..0695844bb5 100644 --- a/metadata/raele.concurseiro.yml +++ b/metadata/raele.concurseiro.yml @@ -3,7 +3,6 @@ Categories: License: GPL-2.0-or-later AutoName: Concurseiro -Summary: Helps you studying Description: Comapanion app for studying. Builds: diff --git a/metadata/raele.concurseiro/en-US/summary.txt b/metadata/raele.concurseiro/en-US/summary.txt new file mode 100644 index 0000000000..3e2b775505 --- /dev/null +++ b/metadata/raele.concurseiro/en-US/summary.txt @@ -0,0 +1 @@ +Helps you studying diff --git a/metadata/re.jcg.playmusicexporter.yml b/metadata/re.jcg.playmusicexporter.yml index 3bd0b01da7..cde1ac5a4d 100644 --- a/metadata/re.jcg.playmusicexporter.yml +++ b/metadata/re.jcg.playmusicexporter.yml @@ -10,7 +10,6 @@ Changelog: https://github.com/playmusicexporter/playmusicexporter/releases Bitcoin: 1NdzpDWPQ53xWT5fraGPZX5F9XrKiPBXjp AutoName: Play Music Exporter -Summary: Export music from Play Music Description: |- (Automatic) Music exporter for Play Music. diff --git a/metadata/re.jcg.playmusicexporter/en-US/summary.txt b/metadata/re.jcg.playmusicexporter/en-US/summary.txt new file mode 100644 index 0000000000..5ea1600e18 --- /dev/null +++ b/metadata/re.jcg.playmusicexporter/en-US/summary.txt @@ -0,0 +1 @@ +Export music from Play Music diff --git a/metadata/remuco.client.android.yml b/metadata/remuco.client.android.yml index 8e3d91ee41..c65bf4c09f 100644 --- a/metadata/remuco.client.android.yml +++ b/metadata/remuco.client.android.yml @@ -4,7 +4,6 @@ License: GPL-3.0-only FlattrID: '141543' AutoName: Remuco -Summary: Remote control for media players Description: |- Remuco is a duplex remote control system for Linux media players and mobile phones equipped with Bluetooth or WiFi. diff --git a/metadata/remuco.client.android/en-US/summary.txt b/metadata/remuco.client.android/en-US/summary.txt new file mode 100644 index 0000000000..1ea3b6beaf --- /dev/null +++ b/metadata/remuco.client.android/en-US/summary.txt @@ -0,0 +1 @@ +Remote control for media players diff --git a/metadata/rino.org.tethercompanion.yml b/metadata/rino.org.tethercompanion.yml index b0c744abbc..6fb4d90c56 100644 --- a/metadata/rino.org.tethercompanion.yml +++ b/metadata/rino.org.tethercompanion.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/RinatKurmaev/Tether-companion/issues Changelog: https://github.com/RinatKurmaev/Tether-companion/releases AutoName: Tether companion -Summary: Show battery level and networking mode on a webserver Description: |- Run a web server with information about battery level and network mode, which are useful for tethering. diff --git a/metadata/rino.org.tethercompanion/en-US/summary.txt b/metadata/rino.org.tethercompanion/en-US/summary.txt new file mode 100644 index 0000000000..b4b1dc4bbf --- /dev/null +++ b/metadata/rino.org.tethercompanion/en-US/summary.txt @@ -0,0 +1 @@ +Show battery level and networking mode on a webserver diff --git a/metadata/rkr.simplekeyboard.inputmethod.yml b/metadata/rkr.simplekeyboard.inputmethod.yml index 7baa197866..d4c0477d14 100644 --- a/metadata/rkr.simplekeyboard.inputmethod.yml +++ b/metadata/rkr.simplekeyboard.inputmethod.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/rkkr/simple-keyboard/issues Changelog: https://github.com/rkkr/simple-keyboard/releases AutoName: Simple Keyboard -Summary: Simply keyboard and nothing more Description: |- This keyboard is created for those who only need a keyboard and nothing more. diff --git a/metadata/rkr.simplekeyboard.inputmethod/en-US/summary.txt b/metadata/rkr.simplekeyboard.inputmethod/en-US/summary.txt new file mode 100644 index 0000000000..0625a263ad --- /dev/null +++ b/metadata/rkr.simplekeyboard.inputmethod/en-US/summary.txt @@ -0,0 +1 @@ +Simply keyboard and nothing more diff --git a/metadata/ro.ciubex.dscautorename.yml b/metadata/ro.ciubex.dscautorename.yml index 475335edbe..bfbe35089d 100644 --- a/metadata/ro.ciubex.dscautorename.yml +++ b/metadata/ro.ciubex.dscautorename.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/ciubex/dscautorename IssueTracker: https://github.com/ciubex/dscautorename/issues AutoName: DSC Auto Rename -Summary: Rename picutres based on date Description: |- Automatically change the name of images files taken by the camera based on the date and time when the file was created. diff --git a/metadata/ro.ciubex.dscautorename/en-US/summary.txt b/metadata/ro.ciubex.dscautorename/en-US/summary.txt new file mode 100644 index 0000000000..5a09183713 --- /dev/null +++ b/metadata/ro.ciubex.dscautorename/en-US/summary.txt @@ -0,0 +1 @@ +Rename picutres based on date diff --git a/metadata/ro.ieval.fonbot.yml b/metadata/ro.ieval.fonbot.yml index c55d870daa..2c68ede594 100644 --- a/metadata/ro.ieval.fonbot.yml +++ b/metadata/ro.ieval.fonbot.yml @@ -6,7 +6,6 @@ IssueTracker: https://bugs.ieval.ro Changelog: https://git.ieval.ro/?p=fonbot.git;a=blob;f=Changes;hb=HEAD AutoName: FonBot -Summary: Control your device remotely Description: |- FonBot lets you send commands to your phone using Yahoo! Messenger, IRC, Jabber and text messages. The commands are executed and the results sent back to your diff --git a/metadata/ro.ieval.fonbot/en-US/summary.txt b/metadata/ro.ieval.fonbot/en-US/summary.txt new file mode 100644 index 0000000000..9f17a39d20 --- /dev/null +++ b/metadata/ro.ieval.fonbot/en-US/summary.txt @@ -0,0 +1 @@ +Control your device remotely diff --git a/metadata/ro.mihai.tpt.yml b/metadata/ro.mihai.tpt.yml index 8d7d9e6e45..44825d9a39 100644 --- a/metadata/ro.mihai.tpt.yml +++ b/metadata/ro.mihai.tpt.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/MihaiBalint/TimisoaraPublicTransport/issues Changelog: https://mihaibalint.github.io/TimisoaraPublicTransport/ AutoName: Public Transport Timisoara -Summary: Get arrival times from Timisoara's PTS Description: |- Get real-time vehicle arrival times from Timisoara's public transport system. diff --git a/metadata/ro.mihai.tpt/en-US/summary.txt b/metadata/ro.mihai.tpt/en-US/summary.txt new file mode 100644 index 0000000000..2f02598265 --- /dev/null +++ b/metadata/ro.mihai.tpt/en-US/summary.txt @@ -0,0 +1 @@ +Get arrival times from Timisoara's PTS diff --git a/metadata/ro.ui.pttdroid.yml b/metadata/ro.ui.pttdroid.yml index eaf96fcfc3..df5cd5901d 100644 --- a/metadata/ro.ui.pttdroid.yml +++ b/metadata/ro.ui.pttdroid.yml @@ -5,7 +5,6 @@ WebSite: https://code.google.com/p/pttdroid SourceCode: https://code.google.com/p/pttdroid/source AutoName: pttdroid -Summary: Walkie Talkie/Push to Talk Description: |- Talk with other people on the same WiFi network. The app uses broadcast and multicast for communication over the same local network (WiFi) and unicast for diff --git a/metadata/ro.ui.pttdroid/en-US/summary.txt b/metadata/ro.ui.pttdroid/en-US/summary.txt new file mode 100644 index 0000000000..0d54303191 --- /dev/null +++ b/metadata/ro.ui.pttdroid/en-US/summary.txt @@ -0,0 +1 @@ +Walkie Talkie/Push to Talk diff --git a/metadata/rodrigodavy.com.github.pixelartist.yml b/metadata/rodrigodavy.com.github.pixelartist.yml index ee6f3b0488..6850f0e9c4 100644 --- a/metadata/rodrigodavy.com.github.pixelartist.yml +++ b/metadata/rodrigodavy.com.github.pixelartist.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/RodrigoDavy/PixelArtist IssueTracker: https://github.com/RodrigoDavy/PixelArtist/issues AutoName: Pixel Artist -Summary: Make Pixel Art on Android Description: |- Give you a pixel grid which you can color any way you like. Allows you to create, save, open and export your pixel art. diff --git a/metadata/rodrigodavy.com.github.pixelartist/en-US/summary.txt b/metadata/rodrigodavy.com.github.pixelartist/en-US/summary.txt new file mode 100644 index 0000000000..9a0b1001ee --- /dev/null +++ b/metadata/rodrigodavy.com.github.pixelartist/en-US/summary.txt @@ -0,0 +1 @@ +Make Pixel Art on Android diff --git a/metadata/rs.pedjaapps.alogcatroot.app.yml b/metadata/rs.pedjaapps.alogcatroot.app.yml index 87b55488a1..35f2d23da9 100644 --- a/metadata/rs.pedjaapps.alogcatroot.app.yml +++ b/metadata/rs.pedjaapps.alogcatroot.app.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/pedja1/aLogcatRoot IssueTracker: https://github.com/pedja1/aLogcatRoot/issues AutoName: aLogcat ROOT -Summary: View system and app log Description: |- An app equivalent of logcat from the terminal. You can filter by importance in the settings: see only errors or view general debugging info. The result can diff --git a/metadata/rs.pedjaapps.alogcatroot.app/en-US/summary.txt b/metadata/rs.pedjaapps.alogcatroot.app/en-US/summary.txt new file mode 100644 index 0000000000..da1d3f4657 --- /dev/null +++ b/metadata/rs.pedjaapps.alogcatroot.app/en-US/summary.txt @@ -0,0 +1 @@ +View system and app log diff --git a/metadata/ru.equestriadev.mgke.yml b/metadata/ru.equestriadev.mgke.yml index c166d0333e..af0bc01a87 100644 --- a/metadata/ru.equestriadev.mgke.yml +++ b/metadata/ru.equestriadev.mgke.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/bronydell/Android-MGKEapp/issues Changelog: https://github.com/bronydell/Android-MGKEapp/releases AutoName: Расписание МГКЭ -Summary: Track updates of schedule on college site Description: |- Tracks updates of schedule on the Minsk gosudarvennogo Electronics College site and shows it in the app. diff --git a/metadata/ru.equestriadev.mgke/en-US/summary.txt b/metadata/ru.equestriadev.mgke/en-US/summary.txt new file mode 100644 index 0000000000..6124a22c9e --- /dev/null +++ b/metadata/ru.equestriadev.mgke/en-US/summary.txt @@ -0,0 +1 @@ +Track updates of schedule on college site diff --git a/metadata/ru.exlmoto.snood21.yml b/metadata/ru.exlmoto.snood21.yml index 9e5fb6ce1b..c4e49219b2 100644 --- a/metadata/ru.exlmoto.snood21.yml +++ b/metadata/ru.exlmoto.snood21.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/EXL/Snooder21 IssueTracker: https://github.com/EXL/Snooder21/issues AutoName: Snooder 21 -Summary: remake of Motorola's standard card game Snood™ 21 Description: |- Snooder 21 is a remake of the very popular Motorola's standard card game Snood™ 21 for Android. diff --git a/metadata/ru.exlmoto.snood21/en-US/summary.txt b/metadata/ru.exlmoto.snood21/en-US/summary.txt new file mode 100644 index 0000000000..af49f3af31 --- /dev/null +++ b/metadata/ru.exlmoto.snood21/en-US/summary.txt @@ -0,0 +1 @@ +remake of Motorola's standard card game Snood™ 21 diff --git a/metadata/ru.gelin.android.browser.open.yml b/metadata/ru.gelin.android.browser.open.yml index ea18ab3ed3..33e0a8f6d6 100644 --- a/metadata/ru.gelin.android.browser.open.yml +++ b/metadata/ru.gelin.android.browser.open.yml @@ -7,7 +7,6 @@ SourceCode: https://bitbucket.org/gelin/open-in-browser/src IssueTracker: https://bitbucket.org/gelin/open-in-browser/issues AutoName: Open in browser -Summary: Open local HTML files in a browser Description: |- Adds ability to open HTML/text/image files saved to SD card from a file manager directly in the browser. diff --git a/metadata/ru.gelin.android.browser.open/en-US/summary.txt b/metadata/ru.gelin.android.browser.open/en-US/summary.txt new file mode 100644 index 0000000000..2c786f3125 --- /dev/null +++ b/metadata/ru.gelin.android.browser.open/en-US/summary.txt @@ -0,0 +1 @@ +Open local HTML files in a browser diff --git a/metadata/ru.gelin.android.sendtosd.yml b/metadata/ru.gelin.android.sendtosd.yml index 56c09ed2c1..f94ef62efb 100644 --- a/metadata/ru.gelin.android.sendtosd.yml +++ b/metadata/ru.gelin.android.sendtosd.yml @@ -6,7 +6,6 @@ IssueTracker: https://bitbucket.org/gelin/send-to-sd/issues Changelog: https://bitbucket.org/gelin/send-to-sd/wiki/History AutoName: Send to SD card -Summary: Copy things to the local storage Description: |- This adds an item to the share menu to save the object to the sdcard. For example, let's say you place a memory card in the phone to look at some diff --git a/metadata/ru.gelin.android.sendtosd/en-US/summary.txt b/metadata/ru.gelin.android.sendtosd/en-US/summary.txt new file mode 100644 index 0000000000..4586d58289 --- /dev/null +++ b/metadata/ru.gelin.android.sendtosd/en-US/summary.txt @@ -0,0 +1 @@ +Copy things to the local storage diff --git a/metadata/ru.gelin.android.weather.notification.skin.biggertext.yml b/metadata/ru.gelin.android.weather.notification.skin.biggertext.yml index c37b427b2c..28971e337a 100644 --- a/metadata/ru.gelin.android.weather.notification.skin.biggertext.yml +++ b/metadata/ru.gelin.android.weather.notification.skin.biggertext.yml @@ -6,7 +6,6 @@ IssueTracker: https://bitbucket.org/gelin/weather-notification/issues Name: 'Weather Skin: Bigger Text' AutoName: 'Weather notification skin: bigger text' -Summary: Theme for Weather Notification Description: Big text skin for [[ru.gelin.android.weather.notification]]. RepoType: srclib diff --git a/metadata/ru.gelin.android.weather.notification.skin.biggertext/en-US/summary.txt b/metadata/ru.gelin.android.weather.notification.skin.biggertext/en-US/summary.txt new file mode 100644 index 0000000000..790064a302 --- /dev/null +++ b/metadata/ru.gelin.android.weather.notification.skin.biggertext/en-US/summary.txt @@ -0,0 +1 @@ +Theme for Weather Notification diff --git a/metadata/ru.gelin.android.weather.notification.skin.blacktext.yml b/metadata/ru.gelin.android.weather.notification.skin.blacktext.yml index e5a9e937bc..9d02de0679 100644 --- a/metadata/ru.gelin.android.weather.notification.skin.blacktext.yml +++ b/metadata/ru.gelin.android.weather.notification.skin.blacktext.yml @@ -6,7 +6,6 @@ IssueTracker: https://bitbucket.org/gelin/weather-notification/issues Name: 'Weather Skin: Black' AutoName: 'Weather notification skin: black text' -Summary: Theme for Weather Notification Description: Black skin for [[ru.gelin.android.weather.notification]]. RepoType: srclib diff --git a/metadata/ru.gelin.android.weather.notification.skin.blacktext/en-US/summary.txt b/metadata/ru.gelin.android.weather.notification.skin.blacktext/en-US/summary.txt new file mode 100644 index 0000000000..790064a302 --- /dev/null +++ b/metadata/ru.gelin.android.weather.notification.skin.blacktext/en-US/summary.txt @@ -0,0 +1 @@ +Theme for Weather Notification diff --git a/metadata/ru.gelin.android.weather.notification.skin.blacktextplus.yml b/metadata/ru.gelin.android.weather.notification.skin.blacktextplus.yml index eda132b767..9b1c5c7d21 100644 --- a/metadata/ru.gelin.android.weather.notification.skin.blacktextplus.yml +++ b/metadata/ru.gelin.android.weather.notification.skin.blacktextplus.yml @@ -6,7 +6,6 @@ IssueTracker: https://bitbucket.org/gelin/weather-notification/issues Name: 'Weather Skin: Black Text Plus' AutoName: 'Weather notification skin: black text plus' -Summary: Theme for Weather Notification Description: Black Text Plus skin for [[ru.gelin.android.weather.notification]]. RepoType: srclib diff --git a/metadata/ru.gelin.android.weather.notification.skin.blacktextplus/en-US/summary.txt b/metadata/ru.gelin.android.weather.notification.skin.blacktextplus/en-US/summary.txt new file mode 100644 index 0000000000..790064a302 --- /dev/null +++ b/metadata/ru.gelin.android.weather.notification.skin.blacktextplus/en-US/summary.txt @@ -0,0 +1 @@ +Theme for Weather Notification diff --git a/metadata/ru.gelin.android.weather.notification.skin.whitetext.yml b/metadata/ru.gelin.android.weather.notification.skin.whitetext.yml index 39855c4fd2..58f6c3d60c 100644 --- a/metadata/ru.gelin.android.weather.notification.skin.whitetext.yml +++ b/metadata/ru.gelin.android.weather.notification.skin.whitetext.yml @@ -6,7 +6,6 @@ IssueTracker: https://bitbucket.org/gelin/weather-notification/issues Name: 'Weather Skin: White' AutoName: 'Weather notification skin: white text' -Summary: Theme for Weather Notification Description: White skin for [[ru.gelin.android.weather.notification]]. RepoType: srclib diff --git a/metadata/ru.gelin.android.weather.notification.skin.whitetext/en-US/summary.txt b/metadata/ru.gelin.android.weather.notification.skin.whitetext/en-US/summary.txt new file mode 100644 index 0000000000..790064a302 --- /dev/null +++ b/metadata/ru.gelin.android.weather.notification.skin.whitetext/en-US/summary.txt @@ -0,0 +1 @@ +Theme for Weather Notification diff --git a/metadata/ru.gelin.android.weather.notification.skin.whitetextplus.yml b/metadata/ru.gelin.android.weather.notification.skin.whitetextplus.yml index e93ac1e289..2ef7cabe17 100644 --- a/metadata/ru.gelin.android.weather.notification.skin.whitetextplus.yml +++ b/metadata/ru.gelin.android.weather.notification.skin.whitetextplus.yml @@ -6,7 +6,6 @@ IssueTracker: https://bitbucket.org/gelin/weather-notification/issues Name: 'Weather Skin: White Text Plus' AutoName: 'Weather notification skin: white text plus' -Summary: Theme for Weather Notification Description: White Text Plus skin for [[ru.gelin.android.weather.notification]]. RepoType: srclib diff --git a/metadata/ru.gelin.android.weather.notification.skin.whitetextplus/en-US/summary.txt b/metadata/ru.gelin.android.weather.notification.skin.whitetextplus/en-US/summary.txt new file mode 100644 index 0000000000..790064a302 --- /dev/null +++ b/metadata/ru.gelin.android.weather.notification.skin.whitetextplus/en-US/summary.txt @@ -0,0 +1 @@ +Theme for Weather Notification diff --git a/metadata/ru.gelin.android.weather.notification.yml b/metadata/ru.gelin.android.weather.notification.yml index b29ec220cb..8c3250d273 100644 --- a/metadata/ru.gelin.android.weather.notification.yml +++ b/metadata/ru.gelin.android.weather.notification.yml @@ -8,7 +8,6 @@ SourceCode: https://bitbucket.org/gelin/weather-notification/src IssueTracker: https://bitbucket.org/gelin/weather-notification/issues AutoName: Weather notification -Summary: Weather info in notification bar Description: |- Simple application which displays the air temperature and other weather conditions in the notification bar. The air temperature is always visible like a diff --git a/metadata/ru.gelin.android.weather.notification/en-US/summary.txt b/metadata/ru.gelin.android.weather.notification/en-US/summary.txt new file mode 100644 index 0000000000..34c189f403 --- /dev/null +++ b/metadata/ru.gelin.android.weather.notification/en-US/summary.txt @@ -0,0 +1 @@ +Weather info in notification bar diff --git a/metadata/ru.henridellal.dialer.yml b/metadata/ru.henridellal.dialer.yml index f724568fa0..1fa9604961 100644 --- a/metadata/ru.henridellal.dialer.yml +++ b/metadata/ru.henridellal.dialer.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/HenriDellal/emerald-dialer/issues Changelog: https://github.com/HenriDellal/emerald-dialer/releases AutoName: Emerald Dialer -Summary: Make calls, view call log Description: |- Emerald Dialer is a lightweight dialer app. diff --git a/metadata/ru.henridellal.dialer/en-US/summary.txt b/metadata/ru.henridellal.dialer/en-US/summary.txt new file mode 100644 index 0000000000..fd32beb481 --- /dev/null +++ b/metadata/ru.henridellal.dialer/en-US/summary.txt @@ -0,0 +1 @@ +Make calls, view call log diff --git a/metadata/ru.henridellal.emerald.yml b/metadata/ru.henridellal.emerald.yml index 9fa81442db..a9036d9bae 100644 --- a/metadata/ru.henridellal.emerald.yml +++ b/metadata/ru.henridellal.emerald.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/HenriDellal/emerald/issues Changelog: https://github.com/HenriDellal/emerald/releases AutoName: Emerald Launcher -Summary: Simple custom home screen Description: |- Lightweight customizable launcher which supports icon packs and has a good number of settings for its size. Features include: diff --git a/metadata/ru.henridellal.emerald/en-US/summary.txt b/metadata/ru.henridellal.emerald/en-US/summary.txt new file mode 100644 index 0000000000..e79f6a0021 --- /dev/null +++ b/metadata/ru.henridellal.emerald/en-US/summary.txt @@ -0,0 +1 @@ +Simple custom home screen diff --git a/metadata/ru.henridellal.patolli.yml b/metadata/ru.henridellal.patolli.yml index 3aef6c0073..dc197622d1 100644 --- a/metadata/ru.henridellal.patolli.yml +++ b/metadata/ru.henridellal.patolli.yml @@ -7,7 +7,6 @@ IssueTracker: https://www.github.com/HenriDellal/patolli/issues Changelog: https://www.github.com/HenriDellal/patolli/releases AutoName: Patolli -Summary: Board game for 1 or 2 players Description: |- Patolli is a board game where players have to guide their markers through the field and back. This game is a simplified version of original Patolli. diff --git a/metadata/ru.henridellal.patolli/en-US/summary.txt b/metadata/ru.henridellal.patolli/en-US/summary.txt new file mode 100644 index 0000000000..4e08b99e9d --- /dev/null +++ b/metadata/ru.henridellal.patolli/en-US/summary.txt @@ -0,0 +1 @@ +Board game for 1 or 2 players diff --git a/metadata/ru.ifproject.android.afr.yml b/metadata/ru.ifproject.android.afr.yml index 364a20a695..66b51cd105 100644 --- a/metadata/ru.ifproject.android.afr.yml +++ b/metadata/ru.ifproject.android.afr.yml @@ -11,7 +11,6 @@ IssueTracker: https://github.com/hexedit/amazfit-face-replacer/issues Changelog: https://github.com/hexedit/amazfit-face-replacer/releases AutoName: AFReplacer -Summary: Replace Amazfit Bip watchfaces in Mi Fit Description: |- This tool allows You to quickly replace custom watchface in Mi Fit. This way You can use 11 custom watchfaces at one time, and there is no need to remember all diff --git a/metadata/ru.ifproject.android.afr/en-US/summary.txt b/metadata/ru.ifproject.android.afr/en-US/summary.txt new file mode 100644 index 0000000000..f666f02ed3 --- /dev/null +++ b/metadata/ru.ifproject.android.afr/en-US/summary.txt @@ -0,0 +1 @@ +Replace Amazfit Bip watchfaces in Mi Fit diff --git a/metadata/ru.meefik.busybox.yml b/metadata/ru.meefik.busybox.yml index 8b9aa79a8d..d6a3c3ec55 100644 --- a/metadata/ru.meefik.busybox.yml +++ b/metadata/ru.meefik.busybox.yml @@ -7,7 +7,6 @@ Changelog: https://github.com/meefik/busybox/blob/HEAD/CHANGELOG Donate: http://meefik.github.io/donate/ AutoName: BusyBox -Summary: Install BusyBox Description: |- Install a recent and un-crippled version of BusyBox. diff --git a/metadata/ru.meefik.busybox/en-US/summary.txt b/metadata/ru.meefik.busybox/en-US/summary.txt new file mode 100644 index 0000000000..e3b29fcded --- /dev/null +++ b/metadata/ru.meefik.busybox/en-US/summary.txt @@ -0,0 +1 @@ +Install BusyBox diff --git a/metadata/ru.meefik.tzupdater.yml b/metadata/ru.meefik.tzupdater.yml index 00c84a35dc..4114672909 100644 --- a/metadata/ru.meefik.tzupdater.yml +++ b/metadata/ru.meefik.tzupdater.yml @@ -8,7 +8,6 @@ Changelog: https://github.com/meefik/tzupdater/blob/HEAD/CHANGELOG Donate: http://meefik.github.io/donate/ AutoName: Timezone Updater -Summary: Update timezone Description: |- Downloads and updates a time zones to latest version on your device. This update should fix all known problems with time zones, such as incorrect time in Android diff --git a/metadata/ru.meefik.tzupdater/en-US/summary.txt b/metadata/ru.meefik.tzupdater/en-US/summary.txt new file mode 100644 index 0000000000..6cfeb688c9 --- /dev/null +++ b/metadata/ru.meefik.tzupdater/en-US/summary.txt @@ -0,0 +1 @@ +Update timezone diff --git a/metadata/ru.moscow.tuzlukov.sergey.weatherlog.yml b/metadata/ru.moscow.tuzlukov.sergey.weatherlog.yml index e5f35dc1c7..d101beab47 100644 --- a/metadata/ru.moscow.tuzlukov.sergey.weatherlog.yml +++ b/metadata/ru.moscow.tuzlukov.sergey.weatherlog.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/sergey-tuzlukov/WeatherLogAndroid IssueTracker: https://github.com/sergey-tuzlukov/WeatherLogAndroid/issues AutoName: WeatherLog -Summary: Log temperature changes Description: |- Shows, how air temperature changed within the previous 24 hours, based on OpenWeatherMap API. Visit the website for detailed information. diff --git a/metadata/ru.moscow.tuzlukov.sergey.weatherlog/en-US/summary.txt b/metadata/ru.moscow.tuzlukov.sergey.weatherlog/en-US/summary.txt new file mode 100644 index 0000000000..d42e74ebeb --- /dev/null +++ b/metadata/ru.moscow.tuzlukov.sergey.weatherlog/en-US/summary.txt @@ -0,0 +1 @@ +Log temperature changes diff --git a/metadata/ru.neverdark.silentnight.yml b/metadata/ru.neverdark.silentnight.yml index 27944c321d..97ce0a94b2 100644 --- a/metadata/ru.neverdark.silentnight.yml +++ b/metadata/ru.neverdark.silentnight.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/yankovskiy/SilentNight IssueTracker: https://github.com/yankovskiy/SilentNight/issues AutoName: Silent Night -Summary: Tell the phone to mute Description: |- Configure the phone to go silent and/or airplane mode between two times of the day. diff --git a/metadata/ru.neverdark.silentnight/en-US/summary.txt b/metadata/ru.neverdark.silentnight/en-US/summary.txt new file mode 100644 index 0000000000..0f360dca72 --- /dev/null +++ b/metadata/ru.neverdark.silentnight/en-US/summary.txt @@ -0,0 +1 @@ +Tell the phone to mute diff --git a/metadata/ru.o2genum.coregame.yml b/metadata/ru.o2genum.coregame.yml index 0da350e4f9..b23100a409 100644 --- a/metadata/ru.o2genum.coregame.yml +++ b/metadata/ru.o2genum.coregame.yml @@ -3,7 +3,6 @@ Categories: License: MIT AutoName: Core -Summary: Simple game Description: |- The rules are simple: diff --git a/metadata/ru.o2genum.coregame/en-US/summary.txt b/metadata/ru.o2genum.coregame/en-US/summary.txt new file mode 100644 index 0000000000..a97af4f524 --- /dev/null +++ b/metadata/ru.o2genum.coregame/en-US/summary.txt @@ -0,0 +1 @@ +Simple game diff --git a/metadata/ru.playsoftware.j2meloader.yml b/metadata/ru.playsoftware.j2meloader.yml index b36d8c5d1a..44f974b667 100644 --- a/metadata/ru.playsoftware.j2meloader.yml +++ b/metadata/ru.playsoftware.j2meloader.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/nikita36078/J2ME-Loader IssueTracker: https://github.com/nikita36078/J2ME-Loader/blob/HEAD/README.md/issues AutoName: J2ME Loader -Summary: J2ME emulator Description: |- J2ME Loader is a J2ME emulator for Android. It supports most 2D games and also 3D with some limitations. Emulator has a virtual keyboard, individual settings diff --git a/metadata/ru.playsoftware.j2meloader/en-US/summary.txt b/metadata/ru.playsoftware.j2meloader/en-US/summary.txt new file mode 100644 index 0000000000..7a7965c3a5 --- /dev/null +++ b/metadata/ru.playsoftware.j2meloader/en-US/summary.txt @@ -0,0 +1 @@ +J2ME emulator diff --git a/metadata/ru.ra66it.updaterforspotify.yml b/metadata/ru.ra66it.updaterforspotify.yml index 26a0df2740..478fc1eb28 100644 --- a/metadata/ru.ra66it.updaterforspotify.yml +++ b/metadata/ru.ra66it.updaterforspotify.yml @@ -9,7 +9,6 @@ IssueTracker: https://github.com/2Ra66it/updater-for-spotify/issues Changelog: https://github.com/2Ra66it/updater-for-spotify/releases AutoName: Updater for Spotify -Summary: Download the latest version of Spotify Description: |- Updater for Spotify allows you to download the latest version of Spotify and Spotify Beta to your android device. diff --git a/metadata/ru.ra66it.updaterforspotify/en-US/summary.txt b/metadata/ru.ra66it.updaterforspotify/en-US/summary.txt new file mode 100644 index 0000000000..1d8e3ab7c5 --- /dev/null +++ b/metadata/ru.ra66it.updaterforspotify/en-US/summary.txt @@ -0,0 +1 @@ +Download the latest version of Spotify diff --git a/metadata/ru.sash0k.bluetooth_terminal.yml b/metadata/ru.sash0k.bluetooth_terminal.yml index 7f8b93fcd1..2eccbbcddf 100644 --- a/metadata/ru.sash0k.bluetooth_terminal.yml +++ b/metadata/ru.sash0k.bluetooth_terminal.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/Sash0k/bluetooth-spp-terminal/issues Changelog: https://github.com/Sash0k/bluetooth-spp-terminal#features AutoName: Bluetooth terminal -Summary: Connect to bluetooth devices Description: |- Bluetooth terminal for debugging and testing: diff --git a/metadata/ru.sash0k.bluetooth_terminal/en-US/summary.txt b/metadata/ru.sash0k.bluetooth_terminal/en-US/summary.txt new file mode 100644 index 0000000000..17acdfe85d --- /dev/null +++ b/metadata/ru.sash0k.bluetooth_terminal/en-US/summary.txt @@ -0,0 +1 @@ +Connect to bluetooth devices diff --git a/metadata/ru.subprogram.paranoidsmsblocker.yml b/metadata/ru.subprogram.paranoidsmsblocker.yml index 59ccd7fe91..d0dfd1450a 100644 --- a/metadata/ru.subprogram.paranoidsmsblocker.yml +++ b/metadata/ru.subprogram.paranoidsmsblocker.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/subprogram/ParanoidSmsBlocker IssueTracker: https://github.com/subprogram/ParanoidSmsBlocker/issues AutoName: Paranoid Sms Blocker -Summary: Block unknown SMS Description: |- Blocks messages from senders not in your contact list, filtering spam. diff --git a/metadata/ru.subprogram.paranoidsmsblocker/en-US/summary.txt b/metadata/ru.subprogram.paranoidsmsblocker/en-US/summary.txt new file mode 100644 index 0000000000..d4722d4f58 --- /dev/null +++ b/metadata/ru.subprogram.paranoidsmsblocker/en-US/summary.txt @@ -0,0 +1 @@ +Block unknown SMS diff --git a/metadata/ru.ttyh.neko259.notey.yml b/metadata/ru.ttyh.neko259.notey.yml index 484cb6c949..141f59daab 100644 --- a/metadata/ru.ttyh.neko259.notey.yml +++ b/metadata/ru.ttyh.neko259.notey.yml @@ -6,7 +6,6 @@ SourceCode: https://bitbucket.org/neko259/notey/src Bitcoin: 1Lh7a1tx7EREENawQyHhiKoCRF6u6TzVrD AutoName: Notey -Summary: Location-aware notes Description: |- Store plain-text or formatted notes, send them via e-mail and see on the OSM map where they were edited. diff --git a/metadata/ru.ttyh.neko259.notey/en-US/summary.txt b/metadata/ru.ttyh.neko259.notey/en-US/summary.txt new file mode 100644 index 0000000000..833ad8eb5c --- /dev/null +++ b/metadata/ru.ttyh.neko259.notey/en-US/summary.txt @@ -0,0 +1 @@ +Location-aware notes diff --git a/metadata/ru.valle.btc.yml b/metadata/ru.valle.btc.yml index 0ee5b2380b..ed8d026cfc 100644 --- a/metadata/ru.valle.btc.yml +++ b/metadata/ru.valle.btc.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/ValleZ/Paper-Wallet IssueTracker: https://github.com/ValleZ/Paper-Wallet/issues AutoName: Paper Wallet -Summary: Back up bitcoins Description: |- Generates a bitcoin address and corresponding private key in 'mini' format. Write down the private key and address then send bitcoins to that address. You diff --git a/metadata/ru.valle.btc/en-US/summary.txt b/metadata/ru.valle.btc/en-US/summary.txt new file mode 100644 index 0000000000..f4a2f8f315 --- /dev/null +++ b/metadata/ru.valle.btc/en-US/summary.txt @@ -0,0 +1 @@ +Back up bitcoins diff --git a/metadata/ru.yanus171.feedexfork.yml b/metadata/ru.yanus171.feedexfork.yml index 1c83911152..a1f3d5fc46 100644 --- a/metadata/ru.yanus171.feedexfork.yml +++ b/metadata/ru.yanus171.feedexfork.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/yanus171/Flym IssueTracker: https://github.com/yanus171/Flym/issues AutoName: Handy News Reader -Summary: RSS reader with full offline support fulltext articles with images Description: | '''Main functions:''' diff --git a/metadata/ru.yanus171.feedexfork/en-US/summary.txt b/metadata/ru.yanus171.feedexfork/en-US/summary.txt new file mode 100644 index 0000000000..a85ea715fb --- /dev/null +++ b/metadata/ru.yanus171.feedexfork/en-US/summary.txt @@ -0,0 +1 @@ +RSS reader with full offline support fulltext articles with images diff --git a/metadata/ru.zxalexis.ugaday.yml b/metadata/ru.zxalexis.ugaday.yml index 215f5fee3d..3d96fc4e40 100644 --- a/metadata/ru.zxalexis.ugaday.yml +++ b/metadata/ru.zxalexis.ugaday.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/zxalexis/guess IssueTracker: https://github.com/zxalexis/guess/issues AutoName: Guess -Summary: Guess a number Description: |- Simple guessing game. The goal is to guess a random number from 1 to 100 with 8 tries. diff --git a/metadata/ru.zxalexis.ugaday/en-US/summary.txt b/metadata/ru.zxalexis.ugaday/en-US/summary.txt new file mode 100644 index 0000000000..2335545957 --- /dev/null +++ b/metadata/ru.zxalexis.ugaday/en-US/summary.txt @@ -0,0 +1 @@ +Guess a number diff --git a/metadata/ru0xdc.rtkgps.yml b/metadata/ru0xdc.rtkgps.yml index 6e3b1dd46c..dd3fc49ea0 100644 --- a/metadata/ru0xdc.rtkgps.yml +++ b/metadata/ru0xdc.rtkgps.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/illarionov/RtkGps IssueTracker: https://github.com/illarionov/RtkGps/issues AutoName: RtkGps -Summary: RTKLIB rtknavi port Description: |- Real-time standard and precise GNSS Positioning on Android using an external Bluetooth or USB GPS receiver; based on RTKLIB. diff --git a/metadata/ru0xdc.rtkgps/en-US/summary.txt b/metadata/ru0xdc.rtkgps/en-US/summary.txt new file mode 100644 index 0000000000..99620aa4e2 --- /dev/null +++ b/metadata/ru0xdc.rtkgps/en-US/summary.txt @@ -0,0 +1 @@ +RTKLIB rtknavi port diff --git a/metadata/ryey.camcov.yml b/metadata/ryey.camcov.yml index 80e2419943..7a44f6b4e5 100644 --- a/metadata/ryey.camcov.yml +++ b/metadata/ryey.camcov.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/renyuneyun/CamCov IssueTracker: https://github.com/renyuneyun/CamCov/issues AutoName: CamCov -Summary: Use your camera as background Description: |- Gain more safety while walking with your eyes on the screen. diff --git a/metadata/ryey.camcov/en-US/summary.txt b/metadata/ryey.camcov/en-US/summary.txt new file mode 100644 index 0000000000..935b83d83d --- /dev/null +++ b/metadata/ryey.camcov/en-US/summary.txt @@ -0,0 +1 @@ +Use your camera as background diff --git a/metadata/ryey.easer.yml b/metadata/ryey.easer.yml index ce0c4e06db..3589aac89e 100644 --- a/metadata/ryey.easer.yml +++ b/metadata/ryey.easer.yml @@ -9,7 +9,6 @@ Donate: https://renyuneyun.github.io/Easer/en/DONATE LiberapayID: '27842' AutoName: Easer -Summary: Event-driven Android automation Description: |- Make your smart phone smarter: tell it what to do under what situation. diff --git a/metadata/ryey.easer/en-US/summary.txt b/metadata/ryey.easer/en-US/summary.txt new file mode 100644 index 0000000000..7e4d55e498 --- /dev/null +++ b/metadata/ryey.easer/en-US/summary.txt @@ -0,0 +1 @@ +Event-driven Android automation diff --git a/metadata/ryey.flock.yml b/metadata/ryey.flock.yml index 5d88d943b5..ad97ad240d 100644 --- a/metadata/ryey.flock.yml +++ b/metadata/ryey.flock.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/renyuneyun/FLock IssueTracker: https://github.com/renyuneyun/FLock/issues AutoName: FLock -Summary: Floating lockscreen button Description: |- Shows a floating lock screen button. diff --git a/metadata/ryey.flock/en-US/summary.txt b/metadata/ryey.flock/en-US/summary.txt new file mode 100644 index 0000000000..cee1ad951e --- /dev/null +++ b/metadata/ryey.flock/en-US/summary.txt @@ -0,0 +1 @@ +Floating lockscreen button diff --git a/metadata/saschpe.contactevents.yml b/metadata/saschpe.contactevents.yml index 9fc88ac9bc..46cc3cc610 100644 --- a/metadata/saschpe.contactevents.yml +++ b/metadata/saschpe.contactevents.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/saschpe/BirthdayCalendar IssueTracker: https://github.com/saschpe/BirthdayCalendar/issues AutoName: Birthday Calendar -Summary: Creates birthday events from all other calendar's data Description: |- Get a birthday calendar for all your social networks right inside Google Calendar. Supports Facebook, LinkedIn, Xing, Skype and all other apps which sync diff --git a/metadata/saschpe.contactevents/en-US/summary.txt b/metadata/saschpe.contactevents/en-US/summary.txt new file mode 100644 index 0000000000..55b2589fd8 --- /dev/null +++ b/metadata/saschpe.contactevents/en-US/summary.txt @@ -0,0 +1 @@ +Creates birthday events from all other calendar's data diff --git a/metadata/saschpe.poker.yml b/metadata/saschpe.poker.yml index 3190177209..29b96babe9 100644 --- a/metadata/saschpe.poker.yml +++ b/metadata/saschpe.poker.yml @@ -5,7 +5,6 @@ WebSite: https://play.google.com/store/apps/details?id=saschpe.poker SourceCode: https://github.com/saschpe/PlanningPoker IssueTracker: https://github.com/saschpe/PlanningPoker/issues -Summary: Planning Poker for phone, tablet and wear devices Description: |- A technique for estimating development goals in software development. diff --git a/metadata/saschpe.poker/en-US/summary.txt b/metadata/saschpe.poker/en-US/summary.txt new file mode 100644 index 0000000000..0f58156aab --- /dev/null +++ b/metadata/saschpe.poker/en-US/summary.txt @@ -0,0 +1 @@ +Planning Poker for phone, tablet and wear devices diff --git a/metadata/science.itaintrocket.pomfshare.yml b/metadata/science.itaintrocket.pomfshare.yml index cfcf523a56..724ebfe4a0 100644 --- a/metadata/science.itaintrocket.pomfshare.yml +++ b/metadata/science.itaintrocket.pomfshare.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/Nyubis/Pomfshare/issues Changelog: https://github.com/Nyubis/Pomfshare/releases AutoName: Pomfshare -Summary: Client for pomf.se Description: |- Pomshare uses Android's built-in sharing menu to easily upload files to [http://pomf.se pomf.se], a free quality filehost. No timeouts, no logins. 50 diff --git a/metadata/science.itaintrocket.pomfshare/en-US/summary.txt b/metadata/science.itaintrocket.pomfshare/en-US/summary.txt new file mode 100644 index 0000000000..ce1a5f391a --- /dev/null +++ b/metadata/science.itaintrocket.pomfshare/en-US/summary.txt @@ -0,0 +1 @@ +Client for pomf.se diff --git a/metadata/se.anyro.nfc_reader.yml b/metadata/se.anyro.nfc_reader.yml index ffd56b3540..661f8f282e 100644 --- a/metadata/se.anyro.nfc_reader.yml +++ b/metadata/se.anyro.nfc_reader.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/nadam/nfc-reader IssueTracker: https://github.com/nadam/nfc-reader/issues AutoName: NFC Reader -Summary: Read NFC tag info Description: |- Simple app for reading and displaying various tags (NDEF, RFID, FeliCa, ISO 14443, etc) using NFC (Near Field Communication). The app also supports basic diff --git a/metadata/se.anyro.nfc_reader/en-US/summary.txt b/metadata/se.anyro.nfc_reader/en-US/summary.txt new file mode 100644 index 0000000000..7b1563eb48 --- /dev/null +++ b/metadata/se.anyro.nfc_reader/en-US/summary.txt @@ -0,0 +1 @@ +Read NFC tag info diff --git a/metadata/se.bitcraze.crazyfliecontrol2.yml b/metadata/se.bitcraze.crazyfliecontrol2.yml index 9301ca5b96..3b227fbac8 100644 --- a/metadata/se.bitcraze.crazyfliecontrol2.yml +++ b/metadata/se.bitcraze.crazyfliecontrol2.yml @@ -9,7 +9,6 @@ IssueTracker: https://github.com/bitcraze/crazyflie-android-client/issues Changelog: https://github.com/bitcraze/crazyflie-android-client/releases AutoName: Crazyflie Client -Summary: Control your Crazyflie quadcopter from your mobile device Description: |- Connect to Crazyflie 2.0 using Bluetooth low energy and both the original Crazyflie and Crazyflie 2.0 using the USB Crazyradio dongle connected with diff --git a/metadata/se.bitcraze.crazyfliecontrol2/en-US/summary.txt b/metadata/se.bitcraze.crazyfliecontrol2/en-US/summary.txt new file mode 100644 index 0000000000..4748e88ccc --- /dev/null +++ b/metadata/se.bitcraze.crazyfliecontrol2/en-US/summary.txt @@ -0,0 +1 @@ +Control your Crazyflie quadcopter from your mobile device diff --git a/metadata/se.danielj.geometridestroyer.yml b/metadata/se.danielj.geometridestroyer.yml index 6ab2bb6147..cda4c5e204 100644 --- a/metadata/se.danielj.geometridestroyer.yml +++ b/metadata/se.danielj.geometridestroyer.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/MaTachi/geometri-destroyer IssueTracker: https://github.com/MaTachi/geometri-destroyer/issues AutoName: Geometri Destroyer -Summary: Simple game Description: Remove the green objects but don't let the blue objects touch the ground. RepoType: git diff --git a/metadata/se.danielj.geometridestroyer/en-US/summary.txt b/metadata/se.danielj.geometridestroyer/en-US/summary.txt new file mode 100644 index 0000000000..a97af4f524 --- /dev/null +++ b/metadata/se.danielj.geometridestroyer/en-US/summary.txt @@ -0,0 +1 @@ +Simple game diff --git a/metadata/se.embargo.retroboy.yml b/metadata/se.embargo.retroboy.yml index 81833635da..3a22ab1cc7 100644 --- a/metadata/se.embargo.retroboy.yml +++ b/metadata/se.embargo.retroboy.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/mikljohansson/retroboy/issues Changelog: https://github.com/mikljohansson/retroboy/releases AutoName: Retroboy -Summary: Retroboy provides vintage imaging technology Description: |- Retroboy provides vintage imaging technology not seen since the digital cameras and monochrome screens of the previous century. A series of real time filters diff --git a/metadata/se.embargo.retroboy/en-US/summary.txt b/metadata/se.embargo.retroboy/en-US/summary.txt new file mode 100644 index 0000000000..0c145bc36d --- /dev/null +++ b/metadata/se.embargo.retroboy/en-US/summary.txt @@ -0,0 +1 @@ +Retroboy provides vintage imaging technology diff --git a/metadata/se.erikofsweden.findmyphone.yml b/metadata/se.erikofsweden.findmyphone.yml index fab6020996..6cebe4ba26 100644 --- a/metadata/se.erikofsweden.findmyphone.yml +++ b/metadata/se.erikofsweden.findmyphone.yml @@ -7,7 +7,6 @@ IssueTracker: https://sourceforge.net/p/findmyphone/_list/tickets?source=navbar Changelog: https://erikofsweden.blogspot.de/p/findmyphone.html AutoName: FindMyPhone -Summary: Helps you find a mislaid phone Description: |- If you lose your phone having this app installed can help you find it. Upon receipt of an SMS or email, FindMyPhone gets your location and communicates the diff --git a/metadata/se.erikofsweden.findmyphone/en-US/summary.txt b/metadata/se.erikofsweden.findmyphone/en-US/summary.txt new file mode 100644 index 0000000000..cc2d66d506 --- /dev/null +++ b/metadata/se.erikofsweden.findmyphone/en-US/summary.txt @@ -0,0 +1 @@ +Helps you find a mislaid phone diff --git a/metadata/se.johanhil.clipboard.yml b/metadata/se.johanhil.clipboard.yml index c111a9048e..8cef63025e 100644 --- a/metadata/se.johanhil.clipboard.yml +++ b/metadata/se.johanhil.clipboard.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/johanhil/copy-to-clipboard IssueTracker: https://github.com/johanhil/copy-to-clipboard/issues AutoName: Copy to Clipboard -Summary: Copy via the share menu Description: |- Copy to Clipboard integrates in to the Share menu, allowing you to copy text to the clipboard instead of sharing via an SMS/e-mail/tweet/etc. diff --git a/metadata/se.johanhil.clipboard/en-US/summary.txt b/metadata/se.johanhil.clipboard/en-US/summary.txt new file mode 100644 index 0000000000..4987a23a84 --- /dev/null +++ b/metadata/se.johanhil.clipboard/en-US/summary.txt @@ -0,0 +1 @@ +Copy via the share menu diff --git a/metadata/se.johanhil.duckduckgo.yml b/metadata/se.johanhil.duckduckgo.yml index da4108f787..f5bea2eea5 100644 --- a/metadata/se.johanhil.duckduckgo.yml +++ b/metadata/se.johanhil.duckduckgo.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/johanhil/ddg-android IssueTracker: https://github.com/johanhil/ddg-android/issues AutoName: Duck Duck Go -Summary: DuckDuckGo search provider Description: |- '''N.B''' This isn't related to the official DuckDuckGo app. diff --git a/metadata/se.johanhil.duckduckgo/en-US/summary.txt b/metadata/se.johanhil.duckduckgo/en-US/summary.txt new file mode 100644 index 0000000000..75db1fe59f --- /dev/null +++ b/metadata/se.johanhil.duckduckgo/en-US/summary.txt @@ -0,0 +1 @@ +DuckDuckGo search provider diff --git a/metadata/se.leap.bitmaskclient.yml b/metadata/se.leap.bitmaskclient.yml index cef8374b45..f4890ffb14 100644 --- a/metadata/se.leap.bitmaskclient.yml +++ b/metadata/se.leap.bitmaskclient.yml @@ -11,7 +11,6 @@ Donate: https://leap.se/en/about-us/donate Bitcoin: 1Fze6GLjoxFnwAGNreYLK8ktFdGJdPRxeY AutoName: Bitmask -Summary: Easy and secure encrypted communication (VPN) Description: |- Bitmask is an application to provide easy and secure encrypted communication. You can choose among several different service providers or start your own. diff --git a/metadata/se.leap.bitmaskclient/en-US/summary.txt b/metadata/se.leap.bitmaskclient/en-US/summary.txt new file mode 100644 index 0000000000..5e14e0273b --- /dev/null +++ b/metadata/se.leap.bitmaskclient/en-US/summary.txt @@ -0,0 +1 @@ +Easy and secure encrypted communication (VPN) diff --git a/metadata/se.leap.riseupvpn.yml b/metadata/se.leap.riseupvpn.yml index a766db2415..29956fe76c 100644 --- a/metadata/se.leap.riseupvpn.yml +++ b/metadata/se.leap.riseupvpn.yml @@ -10,7 +10,6 @@ Donate: https://riseup.net/vpn/donate Bitcoin: 1F3KowUJBfvocr1H6DRvwFxfETJ18e8Dp6 AutoName: RiseupVPN -Summary: Secure VPN powered by Bitmask Description: |- RiseupVPN is an application to provide easy and secure encrypted communication. The app is a custom branded build of [[se.leap.bitmaskclient]]. This version is diff --git a/metadata/se.leap.riseupvpn/en-US/summary.txt b/metadata/se.leap.riseupvpn/en-US/summary.txt new file mode 100644 index 0000000000..1a8967540f --- /dev/null +++ b/metadata/se.leap.riseupvpn/en-US/summary.txt @@ -0,0 +1 @@ +Secure VPN powered by Bitmask diff --git a/metadata/se.manyver.yml b/metadata/se.manyver.yml index af59471b49..89b7098e00 100644 --- a/metadata/se.manyver.yml +++ b/metadata/se.manyver.yml @@ -9,7 +9,6 @@ Donate: https://opencollective.com/manyverse Bitcoin: 3NNGfHL96UrjggaBVQojF1mnGnXNx1SXv7 AutoName: Manyverse -Summary: A social network off the grid Description: |- Manyverse is a social network app using the SSB protocol (Secure Scuttlebutt) where you can write posts and share with friends nearby or over the internet. diff --git a/metadata/se.manyver/en-US/summary.txt b/metadata/se.manyver/en-US/summary.txt new file mode 100644 index 0000000000..027ec0ea21 --- /dev/null +++ b/metadata/se.manyver/en-US/summary.txt @@ -0,0 +1 @@ +A social network off the grid diff --git a/metadata/se.norenh.rkfread.yml b/metadata/se.norenh.rkfread.yml index 721ca6fa89..43ba92f126 100644 --- a/metadata/se.norenh.rkfread.yml +++ b/metadata/se.norenh.rkfread.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/norenh/RKFRead/issues Changelog: https://github.com/norenh/RKFRead/releases AutoName: RKFRead -Summary: Transport card reader Description: |- NFC reader for public travelcards in Sweden and Denmark. It supports reading cards following the RKF standards and is tested with cards from the following diff --git a/metadata/se.norenh.rkfread/en-US/summary.txt b/metadata/se.norenh.rkfread/en-US/summary.txt new file mode 100644 index 0000000000..15a0fbf431 --- /dev/null +++ b/metadata/se.norenh.rkfread/en-US/summary.txt @@ -0,0 +1 @@ +Transport card reader diff --git a/metadata/se.oandell.riksdagen.yml b/metadata/se.oandell.riksdagen.yml index 80ab4b0e0a..7f1997f09e 100644 --- a/metadata/se.oandell.riksdagen.yml +++ b/metadata/se.oandell.riksdagen.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/OAndell/Riksdagskollen/issues Changelog: https://github.com/OAndell/Riksdagskollen/releases AutoName: Riksdagskollen -Summary: Allow users to keep track of the Swedish parliament Description: |- Riksdagskollen aims to make the work of Swedish parliament transparent and easily available for anyone. It lets you: diff --git a/metadata/se.oandell.riksdagen/en-US/summary.txt b/metadata/se.oandell.riksdagen/en-US/summary.txt new file mode 100644 index 0000000000..bd079ee19b --- /dev/null +++ b/metadata/se.oandell.riksdagen/en-US/summary.txt @@ -0,0 +1 @@ +Allow users to keep track of the Swedish parliament diff --git a/metadata/se.pp.mc.android.Gerberoid.yml b/metadata/se.pp.mc.android.Gerberoid.yml index d59362f3fb..e186adfcde 100644 --- a/metadata/se.pp.mc.android.Gerberoid.yml +++ b/metadata/se.pp.mc.android.Gerberoid.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/zeldin/Gerberoid IssueTracker: https://github.com/zeldin/Gerberoid/issues AutoName: Gerberoid -Summary: Viewer for Gerber files Description: |- A viewer for the Gerber PCB image files used in electronics CAD/CAM. The parser and renderer is based on code from the KiCad EDA suite, ensuring a high level of diff --git a/metadata/se.pp.mc.android.Gerberoid/en-US/summary.txt b/metadata/se.pp.mc.android.Gerberoid/en-US/summary.txt new file mode 100644 index 0000000000..b71e04feac --- /dev/null +++ b/metadata/se.pp.mc.android.Gerberoid/en-US/summary.txt @@ -0,0 +1 @@ +Viewer for Gerber files diff --git a/metadata/se.traffar.dot_race.yml b/metadata/se.traffar.dot_race.yml index 6a2e7bfb7d..81bc61eb8f 100644 --- a/metadata/se.traffar.dot_race.yml +++ b/metadata/se.traffar.dot_race.yml @@ -6,7 +6,6 @@ SourceCode: https://bitbucket.org/przemekr/dot-race/src IssueTracker: https://bitbucket.org/przemekr/dot-race/issues AutoName: Dot-Race -Summary: Simple, funny action game Description: |- Dot race is simple, but funny and fast action game. Take a control of your spaceship and compete with computer or an other player in collecting magic diff --git a/metadata/se.traffar.dot_race/en-US/summary.txt b/metadata/se.traffar.dot_race/en-US/summary.txt new file mode 100644 index 0000000000..4e9a555e66 --- /dev/null +++ b/metadata/se.traffar.dot_race/en-US/summary.txt @@ -0,0 +1 @@ +Simple, funny action game diff --git a/metadata/se.tube42.drum.android.yml b/metadata/se.tube42.drum.android.yml index d042a7723a..2befe9dc3a 100644 --- a/metadata/se.tube42.drum.android.yml +++ b/metadata/se.tube42.drum.android.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/tube42/drumon IssueTracker: https://github.com/tube42/drumon/issues AutoName: Drum On! -Summary: Use your smartphone as a virtual drum Description: |- Simple and minimalist drum app that can, for example, be used to accompany guitar or bass players. diff --git a/metadata/se.tube42.drum.android/en-US/summary.txt b/metadata/se.tube42.drum.android/en-US/summary.txt new file mode 100644 index 0000000000..1e97f99d50 --- /dev/null +++ b/metadata/se.tube42.drum.android/en-US/summary.txt @@ -0,0 +1 @@ +Use your smartphone as a virtual drum diff --git a/metadata/se.tube42.kidsmem.android.yml b/metadata/se.tube42.kidsmem.android.yml index 198e5220a5..b8301226cd 100644 --- a/metadata/se.tube42.kidsmem.android.yml +++ b/metadata/se.tube42.kidsmem.android.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/tube42/candymem IssueTracker: https://github.com/tube42/candymem/issues AutoName: Candy Memory -Summary: Match-two memory game Description: |- Candy Memory is a casual "match two" memory game for children and adults. It was created during #CANDYJAM, because everybody loves candy (well, maybe not some diff --git a/metadata/se.tube42.kidsmem.android/en-US/summary.txt b/metadata/se.tube42.kidsmem.android/en-US/summary.txt new file mode 100644 index 0000000000..24cdb9b995 --- /dev/null +++ b/metadata/se.tube42.kidsmem.android/en-US/summary.txt @@ -0,0 +1 @@ +Match-two memory game diff --git a/metadata/se.tube42.p9.android.yml b/metadata/se.tube42.p9.android.yml index 3d33da51bf..9de4a08b6a 100644 --- a/metadata/se.tube42.p9.android.yml +++ b/metadata/se.tube42.p9.android.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/tube42/9p IssueTracker: https://github.com/tube42/9p/issues AutoName: 9P -Summary: Word puzzle game Description: 9P is a 3x3 word puzzle game for Android. RepoType: git diff --git a/metadata/se.tube42.p9.android/en-US/summary.txt b/metadata/se.tube42.p9.android/en-US/summary.txt new file mode 100644 index 0000000000..6c9921e4d5 --- /dev/null +++ b/metadata/se.tube42.p9.android/en-US/summary.txt @@ -0,0 +1 @@ +Word puzzle game diff --git a/metadata/seanfoy.wherering.yml b/metadata/seanfoy.wherering.yml index b5ff8df692..b252456ce0 100644 --- a/metadata/seanfoy.wherering.yml +++ b/metadata/seanfoy.wherering.yml @@ -4,7 +4,6 @@ License: GPL-3.0-only WebSite: https://code.google.com/p/wherering SourceCode: https://code.google.com/p/wherering/source -Summary: Change ring mode by location Description: |- Have the phone's ring mode (silent, vibrate, etc) change when you enter a set location zone, configurable by radius. It uses GPS sparingly to save the diff --git a/metadata/seanfoy.wherering/en-US/summary.txt b/metadata/seanfoy.wherering/en-US/summary.txt new file mode 100644 index 0000000000..f62844ded7 --- /dev/null +++ b/metadata/seanfoy.wherering/en-US/summary.txt @@ -0,0 +1 @@ +Change ring mode by location diff --git a/metadata/security.pEp.yml b/metadata/security.pEp.yml index 75c093ee33..bae921be74 100644 --- a/metadata/security.pEp.yml +++ b/metadata/security.pEp.yml @@ -8,7 +8,6 @@ IssueTracker: https://gitlab.com/pep.security/fdroiddata/issues Changelog: https://www.pep.security/docs/release_notes_android.html AutoName: p≡p -Summary: Read and write encrypted e-mails Description: |- p≡p is a cyber security solution which protects the confidentiality and reliability of communications for citizens, for public offices and for diff --git a/metadata/security.pEp/en-US/summary.txt b/metadata/security.pEp/en-US/summary.txt new file mode 100644 index 0000000000..bb1e2d2114 --- /dev/null +++ b/metadata/security.pEp/en-US/summary.txt @@ -0,0 +1 @@ +Read and write encrypted e-mails diff --git a/metadata/sh.ftp.rocketninelabs.meditationassistant.opensource.yml b/metadata/sh.ftp.rocketninelabs.meditationassistant.opensource.yml index 2d30ba5010..4fad780248 100644 --- a/metadata/sh.ftp.rocketninelabs.meditationassistant.opensource.yml +++ b/metadata/sh.ftp.rocketninelabs.meditationassistant.opensource.yml @@ -10,7 +10,6 @@ Donate: https://rocketnine.space/donate/ LiberapayID: '968545' AutoName: Meditation Assistant Free -Summary: Feature packed meditation session timer and recorder Description: |- This application assists with both timed (via duration or ending at a specific time) and untimed sessions, with numerous customizations, including diff --git a/metadata/sh.ftp.rocketninelabs.meditationassistant.opensource/en-US/summary.txt b/metadata/sh.ftp.rocketninelabs.meditationassistant.opensource/en-US/summary.txt new file mode 100644 index 0000000000..a834be3a6f --- /dev/null +++ b/metadata/sh.ftp.rocketninelabs.meditationassistant.opensource/en-US/summary.txt @@ -0,0 +1 @@ +Feature packed meditation session timer and recorder diff --git a/metadata/si.modrajagoda.didi.yml b/metadata/si.modrajagoda.didi.yml index b0e9ed3ad6..7ccf71bcd2 100644 --- a/metadata/si.modrajagoda.didi.yml +++ b/metadata/si.modrajagoda.didi.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/blaztriglav/did-i/issues Bitcoin: 1FU27EyocpFFhexjoakSe7Hxvf4jD2KmFh AutoName: Did I? -Summary: Recurring todo list Description: |- Did I? is a habit tracking app which asks you a simple question about your habit every day: "Did I?" diff --git a/metadata/si.modrajagoda.didi/en-US/summary.txt b/metadata/si.modrajagoda.didi/en-US/summary.txt new file mode 100644 index 0000000000..0a572fa87c --- /dev/null +++ b/metadata/si.modrajagoda.didi/en-US/summary.txt @@ -0,0 +1 @@ +Recurring todo list diff --git a/metadata/siir.es.adbWireless.yml b/metadata/siir.es.adbWireless.yml index 92d8ad495a..e270456f9f 100644 --- a/metadata/siir.es.adbWireless.yml +++ b/metadata/siir.es.adbWireless.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/slightlywobbly/adbwireless Changelog: https://github.com/slightlywobbly/adbwireless#versions AutoName: adbWireless -Summary: Wireless adb Description: |- adbWireless lets you access your phone through adb without the need of a wired USB connection. The app provides you with the phone's local IP address so that diff --git a/metadata/siir.es.adbWireless/en-US/summary.txt b/metadata/siir.es.adbWireless/en-US/summary.txt new file mode 100644 index 0000000000..f3a5168dde --- /dev/null +++ b/metadata/siir.es.adbWireless/en-US/summary.txt @@ -0,0 +1 @@ +Wireless adb diff --git a/metadata/simple.reboot.com.yml b/metadata/simple.reboot.com.yml index d54a9e66bf..bbee99182b 100644 --- a/metadata/simple.reboot.com.yml +++ b/metadata/simple.reboot.com.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/franciscofranco/Simple-Reboot-app IssueTracker: https://github.com/franciscofranco/Simple-Reboot-app/issues AutoName: Simple Reboot -Summary: Reboot your device Description: |- Choose from reboot, soft reboot, or safe mode options. diff --git a/metadata/simple.reboot.com/en-US/summary.txt b/metadata/simple.reboot.com/en-US/summary.txt new file mode 100644 index 0000000000..0fff3a78fc --- /dev/null +++ b/metadata/simple.reboot.com/en-US/summary.txt @@ -0,0 +1 @@ +Reboot your device diff --git a/metadata/sk.baka.aedict.yml b/metadata/sk.baka.aedict.yml index e1fe50b26c..1e832bac9d 100644 --- a/metadata/sk.baka.aedict.yml +++ b/metadata/sk.baka.aedict.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/mvysny/aedict IssueTracker: https://github.com/mvysny/aedict/issues Bitcoin: 1KJyEutxrm3yL7chvsciMJTvXahXoWE3Pw -Summary: English-Japanese dictionary Description: |- A free, open-source english-japanese dictionary for Android which uses Jim Breen's edict data. Does not require japanese keyboard. Works offline. The diff --git a/metadata/sk.baka.aedict/en-US/summary.txt b/metadata/sk.baka.aedict/en-US/summary.txt new file mode 100644 index 0000000000..8b5938b5ac --- /dev/null +++ b/metadata/sk.baka.aedict/en-US/summary.txt @@ -0,0 +1 @@ +English-Japanese dictionary diff --git a/metadata/sk.halmi.fbeditplus.yml b/metadata/sk.halmi.fbeditplus.yml index 9950174322..47c6534236 100644 --- a/metadata/sk.halmi.fbeditplus.yml +++ b/metadata/sk.halmi.fbeditplus.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/videogameboy76/FBEditPlus IssueTracker: https://github.com/videogameboy76/FBEditPlus/issues AutoName: Frozen Bubble LevelEditor plus -Summary: Edit and load custom level packs for FrozenBubble Description: |- Edit and load custom level packs for [[org.jfedor.frozenbubble]]. Up-/ and downloading is currently broken due to a developer change. diff --git a/metadata/sk.halmi.fbeditplus/en-US/summary.txt b/metadata/sk.halmi.fbeditplus/en-US/summary.txt new file mode 100644 index 0000000000..5fe8a138cb --- /dev/null +++ b/metadata/sk.halmi.fbeditplus/en-US/summary.txt @@ -0,0 +1 @@ +Edit and load custom level packs for FrozenBubble diff --git a/metadata/sk.madzik.android.logcatudp.yml b/metadata/sk.madzik.android.logcatudp.yml index 26cf6e25c4..8f256b0dfb 100644 --- a/metadata/sk.madzik.android.logcatudp.yml +++ b/metadata/sk.madzik.android.logcatudp.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/Chemik/logcatudp IssueTracker: https://github.com/Chemik/logcatudp/issues AutoName: Logcat to UDP -Summary: Wireless logging Description: |- N.B. This probably won't work on Android 4.1+. diff --git a/metadata/sk.madzik.android.logcatudp/en-US/summary.txt b/metadata/sk.madzik.android.logcatudp/en-US/summary.txt new file mode 100644 index 0000000000..63e99d26de --- /dev/null +++ b/metadata/sk.madzik.android.logcatudp/en-US/summary.txt @@ -0,0 +1 @@ +Wireless logging diff --git a/metadata/sk.vx.connectbot.yml b/metadata/sk.vx.connectbot.yml index 85cd8b2c94..13a5a39841 100644 --- a/metadata/sk.vx.connectbot.yml +++ b/metadata/sk.vx.connectbot.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/vx/connectbot IssueTracker: https://github.com/vx/connectbot/issues AutoName: VX ConnectBot -Summary: SSH (remote access) client Description: |- Based on [[org.connectbot]] and other projects. Additional features: diff --git a/metadata/sk.vx.connectbot/en-US/summary.txt b/metadata/sk.vx.connectbot/en-US/summary.txt new file mode 100644 index 0000000000..d399493883 --- /dev/null +++ b/metadata/sk.vx.connectbot/en-US/summary.txt @@ -0,0 +1 @@ +SSH (remote access) client diff --git a/metadata/sonoroxadc.garethmurfin.co.uk.yml b/metadata/sonoroxadc.garethmurfin.co.uk.yml index aa7778ad6d..fcfdebc2ba 100644 --- a/metadata/sonoroxadc.garethmurfin.co.uk.yml +++ b/metadata/sonoroxadc.garethmurfin.co.uk.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/amiga/sonorox IssueTracker: https://github.com/amiga/sonorox/issues AutoName: Sonorox -Summary: Compose quick beats and loops Description: |- It was inspired by the Yamaha Tenori-on and was a finalist in the Android Developer Challenge 2 in 2009. Sonorox allows to compose short loops, and to diff --git a/metadata/sonoroxadc.garethmurfin.co.uk/en-US/summary.txt b/metadata/sonoroxadc.garethmurfin.co.uk/en-US/summary.txt new file mode 100644 index 0000000000..21496bea6e --- /dev/null +++ b/metadata/sonoroxadc.garethmurfin.co.uk/en-US/summary.txt @@ -0,0 +1 @@ +Compose quick beats and loops diff --git a/metadata/sony.hidden.servicemenu.yml b/metadata/sony.hidden.servicemenu.yml index 09dfd9b072..2f76e016cc 100644 --- a/metadata/sony.hidden.servicemenu.yml +++ b/metadata/sony.hidden.servicemenu.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/LeoChirkov/Service-Menu/issues Changelog: https://github.com/LeoChirkov/Service-Menu/releases AutoName: Service Menu -Summary: Start hidden service menu Description: |- Shortcut to a hidden service menu which is also available by dialing a special code in the dialer: diff --git a/metadata/sony.hidden.servicemenu/en-US/summary.txt b/metadata/sony.hidden.servicemenu/en-US/summary.txt new file mode 100644 index 0000000000..49a820df13 --- /dev/null +++ b/metadata/sony.hidden.servicemenu/en-US/summary.txt @@ -0,0 +1 @@ +Start hidden service menu diff --git a/metadata/souch.smp.yml b/metadata/souch.smp.yml index 48431d60c2..ad56f0c4e7 100644 --- a/metadata/souch.smp.yml +++ b/metadata/souch.smp.yml @@ -7,7 +7,6 @@ Changelog: https://gitlab.com/souch/SMP/tags Donate: http://rodolphe.souchaud.free.fr/donate AutoName: SicMu Player -Summary: Tree view based music player Description: |- Lightweight audio player which features a single over-all playlist with every song on the device. diff --git a/metadata/souch.smp/en-US/summary.txt b/metadata/souch.smp/en-US/summary.txt new file mode 100644 index 0000000000..d6a07a1286 --- /dev/null +++ b/metadata/souch.smp/en-US/summary.txt @@ -0,0 +1 @@ +Tree view based music player diff --git a/metadata/souch.smsbypass.yml b/metadata/souch.smsbypass.yml index eb1115f251..86052bf05d 100644 --- a/metadata/souch.smsbypass.yml +++ b/metadata/souch.smsbypass.yml @@ -8,7 +8,6 @@ Donate: http://rodolphe.souchaud.free.fr/donate FlattrID: cad90e036b975ed129a3ce80a0750466 AutoName: Battery level -Summary: Filter SMS and show them in a fake app Description: |- In order to keep away curious eyes, SMS-bypass filters incoming SMS messages before they reach your inbox. Based on [[bughunter2.smsfilter]]. diff --git a/metadata/souch.smsbypass/en-US/summary.txt b/metadata/souch.smsbypass/en-US/summary.txt new file mode 100644 index 0000000000..19d5e6a4d7 --- /dev/null +++ b/metadata/souch.smsbypass/en-US/summary.txt @@ -0,0 +1 @@ +Filter SMS and show them in a fake app diff --git a/metadata/space.neothefox.laytray.yml b/metadata/space.neothefox.laytray.yml index 204e9988fc..5ef766f31c 100644 --- a/metadata/space.neothefox.laytray.yml +++ b/metadata/space.neothefox.laytray.yml @@ -6,7 +6,6 @@ IssueTracker: https://gitlab.com/neothefox/LayTray/issues Changelog: https://gitlab.com/neothefox/LayTray/tags AutoName: LayTray -Summary: Layout indicator for Blackberry phones Description: |- This app keeps a small text icon in the notification area to let you know what Layout you are using. Developed for Blackberry KeyOne and possibly other QWERTY diff --git a/metadata/space.neothefox.laytray/en-US/summary.txt b/metadata/space.neothefox.laytray/en-US/summary.txt new file mode 100644 index 0000000000..553bb0aafa --- /dev/null +++ b/metadata/space.neothefox.laytray/en-US/summary.txt @@ -0,0 +1 @@ +Layout indicator for Blackberry phones diff --git a/metadata/starcom.snd.yml b/metadata/starcom.snd.yml index bb8610ed38..5fb20d7bf7 100644 --- a/metadata/starcom.snd.yml +++ b/metadata/starcom.snd.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/Starcommander/StreamRadio/issues Changelog: https://github.com/Starcommander/StreamRadio/releases AutoName: WebRadio -Summary: Play radio channels from web and add custom channels Description: |- With this app you can play different radio channels from web. There are some pre configured channels, but you can also add custom channels. To add channels you diff --git a/metadata/starcom.snd/en-US/summary.txt b/metadata/starcom.snd/en-US/summary.txt new file mode 100644 index 0000000000..0dd5a46894 --- /dev/null +++ b/metadata/starcom.snd/en-US/summary.txt @@ -0,0 +1 @@ +Play radio channels from web and add custom channels diff --git a/metadata/steele.gerry.dotty.yml b/metadata/steele.gerry.dotty.yml index ec722b3f67..c85f30f6d5 100644 --- a/metadata/steele.gerry.dotty.yml +++ b/metadata/steele.gerry.dotty.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/easytiger/dotty IssueTracker: https://github.com/easytiger/dotty/issues AutoName: Dotty -Summary: Multitouch test Description: |- Dotty is a simple test application for diagnosing multitouch issues on android devices. diff --git a/metadata/steele.gerry.dotty/en-US/summary.txt b/metadata/steele.gerry.dotty/en-US/summary.txt new file mode 100644 index 0000000000..def33d21d3 --- /dev/null +++ b/metadata/steele.gerry.dotty/en-US/summary.txt @@ -0,0 +1 @@ +Multitouch test diff --git a/metadata/streetwalrus.usbmountr.yml b/metadata/streetwalrus.usbmountr.yml index a7759ef3ca..2fc7533f32 100644 --- a/metadata/streetwalrus.usbmountr.yml +++ b/metadata/streetwalrus.usbmountr.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/Streetwalrus/android_usb_msd/issues Changelog: https://github.com/Streetwalrus/android_usb_msd/releases AutoName: USB Mountr -Summary: Use your device as a USB flash drive Description: |- A helper application to set the Mass Storage Device gadget up in Android kernels diff --git a/metadata/streetwalrus.usbmountr/en-US/summary.txt b/metadata/streetwalrus.usbmountr/en-US/summary.txt new file mode 100644 index 0000000000..dd0e194875 --- /dev/null +++ b/metadata/streetwalrus.usbmountr/en-US/summary.txt @@ -0,0 +1 @@ +Use your device as a USB flash drive diff --git a/metadata/subreddit.android.appstore.yml b/metadata/subreddit.android.appstore.yml index 2746602fd0..3a0141c272 100644 --- a/metadata/subreddit.android.appstore.yml +++ b/metadata/subreddit.android.appstore.yml @@ -9,7 +9,6 @@ IssueTracker: https://github.com/d4rken/reddit-android-appstore/issues Changelog: https://github.com/d4rken/reddit-android-appstore/releases AutoName: /r/Android App store -Summary: Download apps curated by /r/android Description: |- App inspired by this [https://www.reddit.com/r/Android/comments/50rafp/meta_we_have_an_app_wiki_with_over_700_apps_made/ diff --git a/metadata/subreddit.android.appstore/en-US/summary.txt b/metadata/subreddit.android.appstore/en-US/summary.txt new file mode 100644 index 0000000000..acd59f223d --- /dev/null +++ b/metadata/subreddit.android.appstore/en-US/summary.txt @@ -0,0 +1 @@ +Download apps curated by /r/android diff --git a/metadata/sun.bob.leela.yml b/metadata/sun.bob.leela.yml index 2201f28293..d239fac223 100644 --- a/metadata/sun.bob.leela.yml +++ b/metadata/sun.bob.leela.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/PuffOpenSource/Puff-Android/issues Changelog: https://github.com/PuffOpenSource/Puff-Android/releases AutoName: Puff -Summary: Password Utility Description: |- Puff provide two ways for quick access your account credentials. diff --git a/metadata/sun.bob.leela/en-US/summary.txt b/metadata/sun.bob.leela/en-US/summary.txt new file mode 100644 index 0000000000..f0fb457275 --- /dev/null +++ b/metadata/sun.bob.leela/en-US/summary.txt @@ -0,0 +1 @@ +Password Utility diff --git a/metadata/swati4star.createpdf.yml b/metadata/swati4star.createpdf.yml index 4e41596d57..2635f5ecf9 100644 --- a/metadata/swati4star.createpdf.yml +++ b/metadata/swati4star.createpdf.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/Swati4star/Images-to-PDF/issues Changelog: https://github.com/Swati4star/Images-to-PDF/releases AutoName: PDF Converter -Summary: Create PDF files Description: |- Convert images to PDF file. diff --git a/metadata/swati4star.createpdf/en-US/summary.txt b/metadata/swati4star.createpdf/en-US/summary.txt new file mode 100644 index 0000000000..efeea6de30 --- /dev/null +++ b/metadata/swati4star.createpdf/en-US/summary.txt @@ -0,0 +1 @@ +Create PDF files diff --git a/metadata/systems.byteswap.aiproute.yml b/metadata/systems.byteswap.aiproute.yml index be23e27801..2fa3f4a380 100644 --- a/metadata/systems.byteswap.aiproute.yml +++ b/metadata/systems.byteswap.aiproute.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/benjaminaigner/aiproute IssueTracker: https://github.com/benjaminaigner/aiproute/issues AutoName: AIProute -Summary: Change IP routes for the Wifi interface Description: |- This app allows you to add specific IP routes on Android to route the IP traffic. It is possible to set address, netmask, gateway and metric. Due to the diff --git a/metadata/systems.byteswap.aiproute/en-US/summary.txt b/metadata/systems.byteswap.aiproute/en-US/summary.txt new file mode 100644 index 0000000000..b68e518c7a --- /dev/null +++ b/metadata/systems.byteswap.aiproute/en-US/summary.txt @@ -0,0 +1 @@ +Change IP routes for the Wifi interface diff --git a/metadata/szelok.app.twister.yml b/metadata/szelok.app.twister.yml index 7a7e557aa1..918c4112d9 100644 --- a/metadata/szelok.app.twister.yml +++ b/metadata/szelok.app.twister.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/szelok/twister-android IssueTracker: https://github.com/szelok/twister-android/issues AutoName: Twister -Summary: Client for Twister Description: Third-party client for the Twister peer-to-peer microblogging platform. RepoType: git diff --git a/metadata/szelok.app.twister/en-US/summary.txt b/metadata/szelok.app.twister/en-US/summary.txt new file mode 100644 index 0000000000..04effa718d --- /dev/null +++ b/metadata/szelok.app.twister/en-US/summary.txt @@ -0,0 +1 @@ +Client for Twister diff --git a/metadata/taco.apkmirror.yml b/metadata/taco.apkmirror.yml index 7f2d96af91..1dab8c04b0 100644 --- a/metadata/taco.apkmirror.yml +++ b/metadata/taco.apkmirror.yml @@ -9,7 +9,6 @@ SourceCode: https://gitlab.com/TacoTheDank/APKMirror IssueTracker: https://gitlab.com/TacoTheDank/APKMirror/issues AutoName: APKMirror -Summary: An unofficial APKMirror client/web app Description: |- An app to browse APKMirror from a device from an app that browses APKMirror and only APKMirror as APKMirror only has apks (which are only used for diff --git a/metadata/taco.apkmirror/en-US/summary.txt b/metadata/taco.apkmirror/en-US/summary.txt new file mode 100644 index 0000000000..fe2e5c87df --- /dev/null +++ b/metadata/taco.apkmirror/en-US/summary.txt @@ -0,0 +1 @@ +An unofficial APKMirror client/web app diff --git a/metadata/teamunguided.brighttime.yml b/metadata/teamunguided.brighttime.yml index 9b6efd1f7c..d6f2fb3c36 100644 --- a/metadata/teamunguided.brighttime.yml +++ b/metadata/teamunguided.brighttime.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/Team-Unguided/BrightTime IssueTracker: https://github.com/Team-Unguided/BrightTime/issues AutoName: BrightTime -Summary: Adjust screen brightness based on time Description: |- Adjusts your screen's brightness based on the time of day. This improves your phone's battery life. Other projects like Backlight! make it easier to manually diff --git a/metadata/teamunguided.brighttime/en-US/summary.txt b/metadata/teamunguided.brighttime/en-US/summary.txt new file mode 100644 index 0000000000..70c405d4a0 --- /dev/null +++ b/metadata/teamunguided.brighttime/en-US/summary.txt @@ -0,0 +1 @@ +Adjust screen brightness based on time diff --git a/metadata/teaonly.droideye.yml b/metadata/teaonly.droideye.yml index 7cb1f7cba0..0add7a8178 100644 --- a/metadata/teaonly.droideye.yml +++ b/metadata/teaonly.droideye.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/Teaonly/android-eye IssueTracker: https://github.com/Teaonly/android-eye/issues AutoName: Wifi Camera -Summary: Internet webcam Description: |- Supports Mjpeg and audio streaming. Built-in web service to see the video via browser on a PC. diff --git a/metadata/teaonly.droideye/en-US/summary.txt b/metadata/teaonly.droideye/en-US/summary.txt new file mode 100644 index 0000000000..f5cb7677f3 --- /dev/null +++ b/metadata/teaonly.droideye/en-US/summary.txt @@ -0,0 +1 @@ +Internet webcam diff --git a/metadata/tech.ula.yml b/metadata/tech.ula.yml index 3b48314cad..47d65282f0 100644 --- a/metadata/tech.ula.yml +++ b/metadata/tech.ula.yml @@ -8,7 +8,6 @@ IssueTracker: https://github.com/CypherpunkArmory/UserLAnd/issues Changelog: https://github.com/CypherpunkArmory/UserLAnd/releases AutoName: UserLAnd -Summary: Easiest way to run GNU/Linux Distros on Android - no root required Description: |- UserLAnd provides the easiest way to run GNU/Linux Distros on Android. diff --git a/metadata/tech.ula/en-US/summary.txt b/metadata/tech.ula/en-US/summary.txt new file mode 100644 index 0000000000..9ee7ca037f --- /dev/null +++ b/metadata/tech.ula/en-US/summary.txt @@ -0,0 +1 @@ +Easiest way to run GNU/Linux Distros on Android - no root required diff --git a/metadata/telegra.ph.yml b/metadata/telegra.ph.yml index 094e4c90c2..95876f73fc 100644 --- a/metadata/telegra.ph.yml +++ b/metadata/telegra.ph.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/jlelse/teleposter/issues Changelog: https://github.com/jlelse/teleposter/releases AutoName: Teleposter -Summary: Write blogposts on telegra.ph Description: |- Independent client app / wrapper around the [http://telegra.ph Telegra.ph] website, which allows to author blogposts. diff --git a/metadata/telegra.ph/en-US/summary.txt b/metadata/telegra.ph/en-US/summary.txt new file mode 100644 index 0000000000..c82d38a6dd --- /dev/null +++ b/metadata/telegra.ph/en-US/summary.txt @@ -0,0 +1 @@ +Write blogposts on telegra.ph diff --git a/metadata/tf.nox.wifisetup.yml b/metadata/tf.nox.wifisetup.yml index a65eba0b0d..7d73eb257f 100644 --- a/metadata/tf.nox.wifisetup.yml +++ b/metadata/tf.nox.wifisetup.yml @@ -4,7 +4,6 @@ License: Apache-2.0 SourceCode: https://github.com/eqvinox/wifisetup AutoName: 34C3 Wifi Setup -Summary: Create secure Wifi connection entry for 33c3 Description: |- Official NOC application for connecting to the 33c3 WiFi. This is a secure profile with CA certificate checking (Let's Encrypt) and certificate subject diff --git a/metadata/tf.nox.wifisetup/en-US/summary.txt b/metadata/tf.nox.wifisetup/en-US/summary.txt new file mode 100644 index 0000000000..708272942a --- /dev/null +++ b/metadata/tf.nox.wifisetup/en-US/summary.txt @@ -0,0 +1 @@ +Create secure Wifi connection entry for 33c3 diff --git a/metadata/theakki.synctool.yml b/metadata/theakki.synctool.yml index 2291d3a105..a3187e419f 100644 --- a/metadata/theakki.synctool.yml +++ b/metadata/theakki.synctool.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/TheAkki/Synctool IssueTracker: https://github.com/TheAkki/Synctool/issues AutoName: SyncTool -Summary: Synchronize data between a smartphone and a server Description: |- Synctool can synchronize data between an Android smartphone and a server with FTP and ownCloud. diff --git a/metadata/theakki.synctool/en-US/summary.txt b/metadata/theakki.synctool/en-US/summary.txt new file mode 100644 index 0000000000..06988a45f9 --- /dev/null +++ b/metadata/theakki.synctool/en-US/summary.txt @@ -0,0 +1 @@ +Synchronize data between a smartphone and a server diff --git a/metadata/theredspy15.ltecleanerfoss.yml b/metadata/theredspy15.ltecleanerfoss.yml index ae2687b20e..1d39ec1794 100644 --- a/metadata/theredspy15.ltecleanerfoss.yml +++ b/metadata/theredspy15.ltecleanerfoss.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/TheRedSpy15/LTECleanerFOSS/issues Changelog: https://github.com/TheRedSpy15/LTECleanerFOSS/releases AutoName: LTE Cleaner (FOSS) -Summary: System cleaner Description: |- Tired of the abundance of phone cleaners on the play store? Tired of them being extremely shady? Tired of them doing nothing? Tired of ads? Tired of having to diff --git a/metadata/theredspy15.ltecleanerfoss/en-US/summary.txt b/metadata/theredspy15.ltecleanerfoss/en-US/summary.txt new file mode 100644 index 0000000000..5426ebbfdf --- /dev/null +++ b/metadata/theredspy15.ltecleanerfoss/en-US/summary.txt @@ -0,0 +1 @@ +System cleaner diff --git a/metadata/tk.al54.dev.badpixels.yml b/metadata/tk.al54.dev.badpixels.yml index f24351d785..9fad38c84b 100644 --- a/metadata/tk.al54.dev.badpixels.yml +++ b/metadata/tk.al54.dev.badpixels.yml @@ -7,7 +7,6 @@ Changelog: https://github.com/SibDev/BadPixels/releases Name: Bad Pixel Detector AutoName: Bad Pixels -Summary: Check for dead pixels Description: |- Check the screen for existence of so-called "dead pixels". So called bad and defective pixels are defects of the electronic device which is perceiving or diff --git a/metadata/tk.al54.dev.badpixels/en-US/summary.txt b/metadata/tk.al54.dev.badpixels/en-US/summary.txt new file mode 100644 index 0000000000..409af04051 --- /dev/null +++ b/metadata/tk.al54.dev.badpixels/en-US/summary.txt @@ -0,0 +1 @@ +Check for dead pixels diff --git a/metadata/tk.elevenk.dailybread.yml b/metadata/tk.elevenk.dailybread.yml index b329af7276..835a0dfc7c 100644 --- a/metadata/tk.elevenk.dailybread.yml +++ b/metadata/tk.elevenk.dailybread.yml @@ -3,7 +3,6 @@ Categories: License: AGPL-3.0-only AutoName: DailybRead -Summary: Find books to download and read Description: |- Finds random books for you to read and download from OpenLibrary. diff --git a/metadata/tk.elevenk.dailybread/en-US/summary.txt b/metadata/tk.elevenk.dailybread/en-US/summary.txt new file mode 100644 index 0000000000..f3e349d422 --- /dev/null +++ b/metadata/tk.elevenk.dailybread/en-US/summary.txt @@ -0,0 +1 @@ +Find books to download and read diff --git a/metadata/tk.giesecke.phoenix.yml b/metadata/tk.giesecke.phoenix.yml index a4b8da6a33..3d53b09199 100644 --- a/metadata/tk.giesecke.phoenix.yml +++ b/metadata/tk.giesecke.phoenix.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/beegee-tokyo/phoenix IssueTracker: https://github.com/beegee-tokyo/phoenix/issues AutoName: Phoenix -Summary: Set time for autoreboot and startup apps Description: |- Reboot your phone in a given interval on a specific time and start a specific application after reboot. The idea is to restart Android and an application diff --git a/metadata/tk.giesecke.phoenix/en-US/summary.txt b/metadata/tk.giesecke.phoenix/en-US/summary.txt new file mode 100644 index 0000000000..f145583894 --- /dev/null +++ b/metadata/tk.giesecke.phoenix/en-US/summary.txt @@ -0,0 +1 @@ +Set time for autoreboot and startup apps diff --git a/metadata/tk.jordynsmediagroup.simpleirc.fdroid.yml b/metadata/tk.jordynsmediagroup.simpleirc.fdroid.yml index b6cc24f231..d7c8673a18 100644 --- a/metadata/tk.jordynsmediagroup.simpleirc.fdroid.yml +++ b/metadata/tk.jordynsmediagroup.simpleirc.fdroid.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/thelinuxgeekcommunity/simpleirc/issues Changelog: https://github.com/thelinuxgeekcommunity/simpleirc/releases AutoName: Simple IRC -Summary: Connect to an IRC server Description: |- A simple IRC client based on [[indrora.atomic]]. diff --git a/metadata/tk.jordynsmediagroup.simpleirc.fdroid/en-US/summary.txt b/metadata/tk.jordynsmediagroup.simpleirc.fdroid/en-US/summary.txt new file mode 100644 index 0000000000..2c3af0a9d4 --- /dev/null +++ b/metadata/tk.jordynsmediagroup.simpleirc.fdroid/en-US/summary.txt @@ -0,0 +1 @@ +Connect to an IRC server diff --git a/metadata/tk.radioactivemineral.metronome.yml b/metadata/tk.radioactivemineral.metronome.yml index d58f6e299d..6e1880cc31 100644 --- a/metadata/tk.radioactivemineral.metronome.yml +++ b/metadata/tk.radioactivemineral.metronome.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/waelk10/Metronome IssueTracker: https://github.com/waelk10/Metronome/issues AutoName: Metronome -Summary: Use your smartphone as a metronome Description: |- Simple metronome app for musicians. diff --git a/metadata/tk.radioactivemineral.metronome/en-US/summary.txt b/metadata/tk.radioactivemineral.metronome/en-US/summary.txt new file mode 100644 index 0000000000..b9057f1613 --- /dev/null +++ b/metadata/tk.radioactivemineral.metronome/en-US/summary.txt @@ -0,0 +1 @@ +Use your smartphone as a metronome diff --git a/metadata/tk.superl2.xwifi.yml b/metadata/tk.superl2.xwifi.yml index 20b223b6eb..2802dbbd1c 100644 --- a/metadata/tk.superl2.xwifi.yml +++ b/metadata/tk.superl2.xwifi.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/hacker1024/android-wifi-qr-code-generator IssueTracker: https://github.com/hacker1024/android-wifi-qr-code-generator/issues AutoName: Wifi QR Code Creator -Summary: View wifi credentials and share networks as QR codes Description: |- An android app that generates QR codes from your saved wifi networks. diff --git a/metadata/tk.superl2.xwifi/en-US/summary.txt b/metadata/tk.superl2.xwifi/en-US/summary.txt new file mode 100644 index 0000000000..4ae2b945d4 --- /dev/null +++ b/metadata/tk.superl2.xwifi/en-US/summary.txt @@ -0,0 +1 @@ +View wifi credentials and share networks as QR codes diff --git a/metadata/tkj.android.homecontrol.mythmote.yml b/metadata/tkj.android.homecontrol.mythmote.yml index a711ba6b16..8dfd5cdada 100644 --- a/metadata/tkj.android.homecontrol.mythmote.yml +++ b/metadata/tkj.android.homecontrol.mythmote.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/pot8oe/mythmote IssueTracker: https://github.com/pot8oe/mythmote/issues AutoName: mythmote -Summary: Remote control for MythTV Description: |- A network remote control for MythTV. diff --git a/metadata/tkj.android.homecontrol.mythmote/en-US/summary.txt b/metadata/tkj.android.homecontrol.mythmote/en-US/summary.txt new file mode 100644 index 0000000000..cd4e90f3eb --- /dev/null +++ b/metadata/tkj.android.homecontrol.mythmote/en-US/summary.txt @@ -0,0 +1 @@ +Remote control for MythTV diff --git a/metadata/tmendes.com.analyticalbalancedroid.yml b/metadata/tmendes.com.analyticalbalancedroid.yml index 0573128263..bb26283873 100644 --- a/metadata/tmendes.com.analyticalbalancedroid.yml +++ b/metadata/tmendes.com.analyticalbalancedroid.yml @@ -6,7 +6,6 @@ SourceCode: https://gitlab.com/tmendes/FoodScaleDroid IssueTracker: https://gitlab.com/tmendes/FoodScaleDroid/issues AutoName: Food Scale Droid -Summary: Scale prices to common base units Description: |- For that time when you go to the market and you buy many small packs of different weight prices and different weights you end up a bit lost. diff --git a/metadata/tmendes.com.analyticalbalancedroid/en-US/summary.txt b/metadata/tmendes.com.analyticalbalancedroid/en-US/summary.txt new file mode 100644 index 0000000000..fbdad33187 --- /dev/null +++ b/metadata/tmendes.com.analyticalbalancedroid/en-US/summary.txt @@ -0,0 +1 @@ +Scale prices to common base units diff --git a/metadata/to.networld.android.divedroid.yml b/metadata/to.networld.android.divedroid.yml index 40d0950cf1..318761cbb6 100644 --- a/metadata/to.networld.android.divedroid.yml +++ b/metadata/to.networld.android.divedroid.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/obale/divedroid IssueTracker: https://github.com/obale/divedroid/issues AutoName: DiveDroid -Summary: Scuba Dive Logbook Description: |- Android Dive Logbook. Based on [http://scubadive.networld.to]. diff --git a/metadata/to.networld.android.divedroid/en-US/summary.txt b/metadata/to.networld.android.divedroid/en-US/summary.txt new file mode 100644 index 0000000000..6b12e66622 --- /dev/null +++ b/metadata/to.networld.android.divedroid/en-US/summary.txt @@ -0,0 +1 @@ +Scuba Dive Logbook diff --git a/metadata/tomer.com.alwaysonamoledplugin.yml b/metadata/tomer.com.alwaysonamoledplugin.yml index 730c10964a..01e7ff16dc 100644 --- a/metadata/tomer.com.alwaysonamoledplugin.yml +++ b/metadata/tomer.com.alwaysonamoledplugin.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/rosenpin/AlwaysOnAmoledPlugin IssueTracker: https://github.com/rosenpin/AlwaysOnAmoledPlugin/issues AutoName: Always On AMOLED Plugin -Summary: Control capacitive button lights via Always On AMOLED Description: |- This plugin for [[com.tomer.alwayson]] is required for devices with capacitive buttons. Turns the hardware buttons light off/on. diff --git a/metadata/tomer.com.alwaysonamoledplugin/en-US/summary.txt b/metadata/tomer.com.alwaysonamoledplugin/en-US/summary.txt new file mode 100644 index 0000000000..c4f11996da --- /dev/null +++ b/metadata/tomer.com.alwaysonamoledplugin/en-US/summary.txt @@ -0,0 +1 @@ +Control capacitive button lights via Always On AMOLED diff --git a/metadata/tranquvis.simplesmsremote.yml b/metadata/tranquvis.simplesmsremote.yml index 7df99d9327..f75aa5199d 100644 --- a/metadata/tranquvis.simplesmsremote.yml +++ b/metadata/tranquvis.simplesmsremote.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/tranquvis/SimpleSmsRemote/issues Changelog: https://github.com/tranquvis/SimpleSmsRemote/releases AutoName: Simple sms remote -Summary: Control your device by sending text messages Description: |- Remotely control a phone through sms messages. Install the app on the device, which should be controlled, and send control commands from any messenger to it. diff --git a/metadata/tranquvis.simplesmsremote/en-US/summary.txt b/metadata/tranquvis.simplesmsremote/en-US/summary.txt new file mode 100644 index 0000000000..1150e6545e --- /dev/null +++ b/metadata/tranquvis.simplesmsremote/en-US/summary.txt @@ -0,0 +1 @@ +Control your device by sending text messages diff --git a/metadata/trikita.obsqr.yml b/metadata/trikita.obsqr.yml index 8fde841bdf..b5b989dd2e 100644 --- a/metadata/trikita.obsqr.yml +++ b/metadata/trikita.obsqr.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/trikita/obsqr IssueTracker: https://github.com/trikita/obsqr/issues AutoName: Obsqr -Summary: Scan QR codes Description: |- Fast and simple QR code scanner that uses the zbar library. Minimalistic design allows you to access QR content with a single tap. diff --git a/metadata/trikita.obsqr/en-US/summary.txt b/metadata/trikita.obsqr/en-US/summary.txt new file mode 100644 index 0000000000..f011c2ef78 --- /dev/null +++ b/metadata/trikita.obsqr/en-US/summary.txt @@ -0,0 +1 @@ +Scan QR codes diff --git a/metadata/trikita.slide.yml b/metadata/trikita.slide.yml index 5f1f10ec2a..d398e214e8 100644 --- a/metadata/trikita.slide.yml +++ b/metadata/trikita.slide.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/trikita/slide IssueTracker: https://github.com/trikita/slide/issues AutoName: Slide -Summary: Minimal presentation tool, perfect for using Takahashi method Description: |- Unlike a typical presentation, only a few words are printed on each slide using very large characters. To make up for this, a presenter will use many more diff --git a/metadata/trikita.slide/en-US/summary.txt b/metadata/trikita.slide/en-US/summary.txt new file mode 100644 index 0000000000..c947940ee1 --- /dev/null +++ b/metadata/trikita.slide/en-US/summary.txt @@ -0,0 +1 @@ +Minimal presentation tool, perfect for using Takahashi method diff --git a/metadata/trikita.talalarmo.yml b/metadata/trikita.talalarmo.yml index 793114051c..89444cb08e 100644 --- a/metadata/trikita.talalarmo.yml +++ b/metadata/trikita.talalarmo.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/trikita/talalarmo IssueTracker: https://github.com/trikita/talalarmo/issues AutoName: Talalarmo -Summary: Minimal, simple and beautiful alarm clock Description: |- Minimal, simple and beautiful alarm clock thoughtfully designed by nap enthusiasts. It does only one function but does it well. Only one alarm time is diff --git a/metadata/trikita.talalarmo/en-US/summary.txt b/metadata/trikita.talalarmo/en-US/summary.txt new file mode 100644 index 0000000000..6db4d704ad --- /dev/null +++ b/metadata/trikita.talalarmo/en-US/summary.txt @@ -0,0 +1 @@ +Minimal, simple and beautiful alarm clock diff --git a/metadata/tritop.android.SLWTrafficMeterWidget.yml b/metadata/tritop.android.SLWTrafficMeterWidget.yml index 4def45a021..f297ee0f75 100644 --- a/metadata/tritop.android.SLWTrafficMeterWidget.yml +++ b/metadata/tritop.android.SLWTrafficMeterWidget.yml @@ -5,7 +5,6 @@ WebSite: https://code.google.com/p/slw-battery-widget SourceCode: https://code.google.com/p/slw-battery-widget/source AutoName: SLW Traffic Meter Widget -Summary: Simple internet traffic widget Description: Phone my need to reboot before widget becomes available Builds: diff --git a/metadata/tritop.android.SLWTrafficMeterWidget/en-US/summary.txt b/metadata/tritop.android.SLWTrafficMeterWidget/en-US/summary.txt new file mode 100644 index 0000000000..291005c69c --- /dev/null +++ b/metadata/tritop.android.SLWTrafficMeterWidget/en-US/summary.txt @@ -0,0 +1 @@ +Simple internet traffic widget diff --git a/metadata/tritop.androidSLWCpuWidget.yml b/metadata/tritop.androidSLWCpuWidget.yml index 48d9c16249..fa549bdde0 100644 --- a/metadata/tritop.androidSLWCpuWidget.yml +++ b/metadata/tritop.androidSLWCpuWidget.yml @@ -5,7 +5,6 @@ WebSite: https://code.google.com/p/slw-battery-widget SourceCode: https://code.google.com/p/slw-battery-widget/source AutoName: SLW Cpu Widget -Summary: Simple CPU widget Description: Phone may need to be rebooted on android 4+ for the widget to be available Builds: diff --git a/metadata/tritop.androidSLWCpuWidget/en-US/summary.txt b/metadata/tritop.androidSLWCpuWidget/en-US/summary.txt new file mode 100644 index 0000000000..d189a157ea --- /dev/null +++ b/metadata/tritop.androidSLWCpuWidget/en-US/summary.txt @@ -0,0 +1 @@ +Simple CPU widget diff --git a/metadata/troop.com.freedcam.yml b/metadata/troop.com.freedcam.yml index e959cadd3e..b6096c14ad 100644 --- a/metadata/troop.com.freedcam.yml +++ b/metadata/troop.com.freedcam.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/KillerInk/FreeDcam IssueTracker: https://github.com/KillerInk/FreeDcam/issues AutoName: FreeDCam -Summary: Camera app Description: |- FreeDCam is an open source camera app which try to enable stuff that is forgotten by the manufacturers. diff --git a/metadata/troop.com.freedcam/en-US/summary.txt b/metadata/troop.com.freedcam/en-US/summary.txt new file mode 100644 index 0000000000..6f09d02baf --- /dev/null +++ b/metadata/troop.com.freedcam/en-US/summary.txt @@ -0,0 +1 @@ +Camera app diff --git a/metadata/tuioDroid.impl.yml b/metadata/tuioDroid.impl.yml index a13d82873a..6813b32917 100644 --- a/metadata/tuioDroid.impl.yml +++ b/metadata/tuioDroid.impl.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/TobiasSchwirten/tuiodroid/issues Changelog: https://raw.githubusercontent.com/TobiasSchwirten/tuiodroid/HEAD/TUIOdroid/changelog.txt AutoName: TUIOdroid -Summary: Send multitouch events Description: |- A TUIO tracker which allows multi-touch control input, which is sent to a remote address using the TUIO protocol. diff --git a/metadata/tuioDroid.impl/en-US/summary.txt b/metadata/tuioDroid.impl/en-US/summary.txt new file mode 100644 index 0000000000..5c6c4b12f7 --- /dev/null +++ b/metadata/tuioDroid.impl/en-US/summary.txt @@ -0,0 +1 @@ +Send multitouch events diff --git a/metadata/tv.piratemedia.lightcontroler.yml b/metadata/tv.piratemedia.lightcontroler.yml index aee1fb4cb0..e948a86af4 100644 --- a/metadata/tv.piratemedia.lightcontroler.yml +++ b/metadata/tv.piratemedia.lightcontroler.yml @@ -9,7 +9,6 @@ IssueTracker: https://github.com/eliotstocker/Light-Controller/issues Changelog: https://github.com/eliotstocker/Light-Controller/blob/HEAD/changelog.md AutoName: Light controller -Summary: Control WiFi light bulbs Description: |- Control LED bulbs from following manufacturers: diff --git a/metadata/tv.piratemedia.lightcontroler/en-US/summary.txt b/metadata/tv.piratemedia.lightcontroler/en-US/summary.txt new file mode 100644 index 0000000000..5cb12bc632 --- /dev/null +++ b/metadata/tv.piratemedia.lightcontroler/en-US/summary.txt @@ -0,0 +1 @@ +Control WiFi light bulbs diff --git a/metadata/tw.com.daxia.virtualsoftkeys.yml b/metadata/tw.com.daxia.virtualsoftkeys.yml index 5f7229561c..e8da2122d1 100644 --- a/metadata/tw.com.daxia.virtualsoftkeys.yml +++ b/metadata/tw.com.daxia.virtualsoftkeys.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/DaxiaK/VirtualSoftKeys IssueTracker: https://github.com/DaxiaK/VirtualSoftKeys/issues AutoName: VirtualSoftKeys -Summary: A simple, safe and easy softKeys (navigation bar) Description: |- Features: * As system navigation bar diff --git a/metadata/tw.com.daxia.virtualsoftkeys/en-US/summary.txt b/metadata/tw.com.daxia.virtualsoftkeys/en-US/summary.txt new file mode 100644 index 0000000000..836c7b259b --- /dev/null +++ b/metadata/tw.com.daxia.virtualsoftkeys/en-US/summary.txt @@ -0,0 +1 @@ +A simple, safe and easy softKeys (navigation bar) diff --git a/metadata/tw.qtlin.mac.airunlocker.yml b/metadata/tw.qtlin.mac.airunlocker.yml index 6bac60b966..a8b93458bf 100644 --- a/metadata/tw.qtlin.mac.airunlocker.yml +++ b/metadata/tw.qtlin.mac.airunlocker.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/pinetum/AirUnlock-for-Android/issues Changelog: https://github.com/pinetum/AirUnlock-for-Android/releases AutoName: AirUnlock -Summary: Controlling Mac lock state Description: |- Using android phone to establish a connection with your Mac via Bluetooth low-energy(BLE), controlling Mac lock state (Lock or Unlock). diff --git a/metadata/tw.qtlin.mac.airunlocker/en-US/summary.txt b/metadata/tw.qtlin.mac.airunlocker/en-US/summary.txt new file mode 100644 index 0000000000..1f846e5271 --- /dev/null +++ b/metadata/tw.qtlin.mac.airunlocker/en-US/summary.txt @@ -0,0 +1 @@ +Controlling Mac lock state diff --git a/metadata/tyagi.shubham.customsearch.yml b/metadata/tyagi.shubham.customsearch.yml index 599e17f498..0d50479670 100644 --- a/metadata/tyagi.shubham.customsearch.yml +++ b/metadata/tyagi.shubham.customsearch.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/SubhamTyagi/dork-explore IssueTracker: https://github.com/SubhamTyagi/dork-explore/issues AutoName: Custom Search -Summary: A Simple Query Search on Google using Dorking Description: |- This app uses a simple Google dorking to search on Google for exact result of search. diff --git a/metadata/tyagi.shubham.customsearch/en-US/summary.txt b/metadata/tyagi.shubham.customsearch/en-US/summary.txt new file mode 100644 index 0000000000..74316820d0 --- /dev/null +++ b/metadata/tyagi.shubham.customsearch/en-US/summary.txt @@ -0,0 +1 @@ +A Simple Query Search on Google using Dorking diff --git a/metadata/uk.ac.cam.cl.dtg.android.barcodebox.yml b/metadata/uk.ac.cam.cl.dtg.android.barcodebox.yml index 2a2220a1b9..5daeac7620 100644 --- a/metadata/uk.ac.cam.cl.dtg.android.barcodebox.yml +++ b/metadata/uk.ac.cam.cl.dtg.android.barcodebox.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/ucam-cl-dtg/barcodebox IssueTracker: https://github.com/ucam-cl-dtg/barcodebox/issues AutoName: Barcode Box 2 -Summary: Barcode scan history Description: |- You will need [[com.google.zxing.client.android]] to be installed. diff --git a/metadata/uk.ac.cam.cl.dtg.android.barcodebox/en-US/summary.txt b/metadata/uk.ac.cam.cl.dtg.android.barcodebox/en-US/summary.txt new file mode 100644 index 0000000000..27eac9afdc --- /dev/null +++ b/metadata/uk.ac.cam.cl.dtg.android.barcodebox/en-US/summary.txt @@ -0,0 +1 @@ +Barcode scan history diff --git a/metadata/uk.ac.ed.inf.mandelbrotmaps.yml b/metadata/uk.ac.ed.inf.mandelbrotmaps.yml index a579e1970d..a48b9249cd 100644 --- a/metadata/uk.ac.ed.inf.mandelbrotmaps.yml +++ b/metadata/uk.ac.ed.inf.mandelbrotmaps.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/withad/Mandelbrot-Maps-on-Android IssueTracker: https://github.com/withad/Mandelbrot-Maps-on-Android/issues AutoName: Mandelbrot Maps -Summary: Fractal viewer Description: |- Generates the Mandelbrot fractal, and at each point, allows you to see the associated Julia set fractal. diff --git a/metadata/uk.ac.ed.inf.mandelbrotmaps/en-US/summary.txt b/metadata/uk.ac.ed.inf.mandelbrotmaps/en-US/summary.txt new file mode 100644 index 0000000000..a27afde437 --- /dev/null +++ b/metadata/uk.ac.ed.inf.mandelbrotmaps/en-US/summary.txt @@ -0,0 +1 @@ +Fractal viewer diff --git a/metadata/uk.ac.swansea.eduroamcat.yml b/metadata/uk.ac.swansea.eduroamcat.yml index f44479e77a..a55093905e 100644 --- a/metadata/uk.ac.swansea.eduroamcat.yml +++ b/metadata/uk.ac.swansea.eduroamcat.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/GEANT/CAT-Android/issues Changelog: https://github.com/GEANT/CAT-Android/releases AutoName: eduroamCAT -Summary: eduroam Configuration Assistant Tool Description: |- ''EduroamCAT'' is an eduroam Configuration Assistant Tool corresponding to website https://cat.eduroam.org diff --git a/metadata/uk.ac.swansea.eduroamcat/en-US/summary.txt b/metadata/uk.ac.swansea.eduroamcat/en-US/summary.txt new file mode 100644 index 0000000000..7c540d0b4e --- /dev/null +++ b/metadata/uk.ac.swansea.eduroamcat/en-US/summary.txt @@ -0,0 +1 @@ +eduroam Configuration Assistant Tool diff --git a/metadata/uk.co.ashtonbrsc.android.intentintercept.yml b/metadata/uk.co.ashtonbrsc.android.intentintercept.yml index 6f9cf1592a..9ee3547179 100644 --- a/metadata/uk.co.ashtonbrsc.android.intentintercept.yml +++ b/metadata/uk.co.ashtonbrsc.android.intentintercept.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/intrications/intent-intercept IssueTracker: https://github.com/intrications/intent-intercept/issues AutoName: Intent Intercept -Summary: View inter-app communication Description: |- '''Currently unmaintained''': A maintained fork is available here [[de.k3b.android.intentintercept]]. diff --git a/metadata/uk.co.ashtonbrsc.android.intentintercept/en-US/summary.txt b/metadata/uk.co.ashtonbrsc.android.intentintercept/en-US/summary.txt new file mode 100644 index 0000000000..595890374e --- /dev/null +++ b/metadata/uk.co.ashtonbrsc.android.intentintercept/en-US/summary.txt @@ -0,0 +1 @@ +View inter-app communication diff --git a/metadata/uk.co.bitethebullet.android.token.yml b/metadata/uk.co.bitethebullet.android.token.yml index dee264ad29..bb3b367235 100644 --- a/metadata/uk.co.bitethebullet.android.token.yml +++ b/metadata/uk.co.bitethebullet.android.token.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/markmcavoy/androidtoken IssueTracker: https://github.com/markmcavoy/androidtoken/issues AutoName: Android Token -Summary: OATH software tokens Description: |- Turning a mobile phone into a One Time Password (OTP) generation device which can be used in the place of hardware tokens. diff --git a/metadata/uk.co.bitethebullet.android.token/en-US/summary.txt b/metadata/uk.co.bitethebullet.android.token/en-US/summary.txt new file mode 100644 index 0000000000..09e614b2aa --- /dev/null +++ b/metadata/uk.co.bitethebullet.android.token/en-US/summary.txt @@ -0,0 +1 @@ +OATH software tokens diff --git a/metadata/uk.co.busydoingnothing.catverbs.yml b/metadata/uk.co.busydoingnothing.catverbs.yml index 4414a37a2d..009232a807 100644 --- a/metadata/uk.co.busydoingnothing.catverbs.yml +++ b/metadata/uk.co.busydoingnothing.catverbs.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/bpeel/catverbs IssueTracker: https://github.com/bpeel/catverbs/issues AutoName: Catverbs -Summary: Catalan verb conjugation Description: |- Catverbs can be used as a reference for the conjugation of most catalan verbs. Its interface is in catalan as well. diff --git a/metadata/uk.co.busydoingnothing.catverbs/en-US/summary.txt b/metadata/uk.co.busydoingnothing.catverbs/en-US/summary.txt new file mode 100644 index 0000000000..be27f70bb1 --- /dev/null +++ b/metadata/uk.co.busydoingnothing.catverbs/en-US/summary.txt @@ -0,0 +1 @@ +Catalan verb conjugation diff --git a/metadata/uk.co.busydoingnothing.prevo.yml b/metadata/uk.co.busydoingnothing.prevo.yml index 96f908042d..f8acb446bd 100644 --- a/metadata/uk.co.busydoingnothing.prevo.yml +++ b/metadata/uk.co.busydoingnothing.prevo.yml @@ -6,7 +6,6 @@ WebSite: http://www.busydoingnothing.co.uk/prevo SourceCode: https://github.com/bpeel/prevo IssueTracker: https://github.com/bpeel/prevo/issues -Summary: Esperanto dictionary Description: |- PReVo is a portable version of Reta Vortaro (the free and libre Esperanto dictionary) for Android. It's usable without Internet access and is quickly diff --git a/metadata/uk.co.busydoingnothing.prevo/en-US/summary.txt b/metadata/uk.co.busydoingnothing.prevo/en-US/summary.txt new file mode 100644 index 0000000000..6ef2a8ad54 --- /dev/null +++ b/metadata/uk.co.busydoingnothing.prevo/en-US/summary.txt @@ -0,0 +1 @@ +Esperanto dictionary diff --git a/metadata/uk.co.danieljarvis.android.flashback.yml b/metadata/uk.co.danieljarvis.android.flashback.yml index ac8fd01030..b509b904d5 100644 --- a/metadata/uk.co.danieljarvis.android.flashback.yml +++ b/metadata/uk.co.danieljarvis.android.flashback.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/daj/flashback IssueTracker: https://github.com/daj/flashback/issues AutoName: Flashback -Summary: Display caller history Description: |- When you receive a call the app displays the history of your interactions with the caller. diff --git a/metadata/uk.co.danieljarvis.android.flashback/en-US/summary.txt b/metadata/uk.co.danieljarvis.android.flashback/en-US/summary.txt new file mode 100644 index 0000000000..bc51a26f3f --- /dev/null +++ b/metadata/uk.co.danieljarvis.android.flashback/en-US/summary.txt @@ -0,0 +1 @@ +Display caller history diff --git a/metadata/uk.co.jarofgreen.JustADamnCompass.yml b/metadata/uk.co.jarofgreen.JustADamnCompass.yml index 53594489ff..5bf7f14a42 100644 --- a/metadata/uk.co.jarofgreen.JustADamnCompass.yml +++ b/metadata/uk.co.jarofgreen.JustADamnCompass.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/jarofgreen/Just-A-Damn-Compass IssueTracker: https://github.com/jarofgreen/Just-A-Damn-Compass/issues AutoName: Just A Damn Compass -Summary: Simple Compass Description: A simple compass with no unnecessary extras. RepoType: git diff --git a/metadata/uk.co.jarofgreen.JustADamnCompass/en-US/summary.txt b/metadata/uk.co.jarofgreen.JustADamnCompass/en-US/summary.txt new file mode 100644 index 0000000000..ef67703c74 --- /dev/null +++ b/metadata/uk.co.jarofgreen.JustADamnCompass/en-US/summary.txt @@ -0,0 +1 @@ +Simple Compass diff --git a/metadata/uk.co.keepawayfromfire.screens.yml b/metadata/uk.co.keepawayfromfire.screens.yml index 77dc3a05df..a83b8982e5 100644 --- a/metadata/uk.co.keepawayfromfire.screens.yml +++ b/metadata/uk.co.keepawayfromfire.screens.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/Cj-Malone/Screens/issues Changelog: https://raw.githubusercontent.com/Cj-Malone/Screens/HEAD/CHANGELOG.md AutoName: Screens -Summary: Multi Window Manager Description: |- Automatically enter split screen mode from launcher shortcuts and Quick Settings tiles. diff --git a/metadata/uk.co.keepawayfromfire.screens/en-US/summary.txt b/metadata/uk.co.keepawayfromfire.screens/en-US/summary.txt new file mode 100644 index 0000000000..f6384cff63 --- /dev/null +++ b/metadata/uk.co.keepawayfromfire.screens/en-US/summary.txt @@ -0,0 +1 @@ +Multi Window Manager diff --git a/metadata/uk.co.richyhbm.monochromatic.yml b/metadata/uk.co.richyhbm.monochromatic.yml index 37ece5b8da..a527d4fcc5 100644 --- a/metadata/uk.co.richyhbm.monochromatic.yml +++ b/metadata/uk.co.richyhbm.monochromatic.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/RichyHBM/Monochromatic IssueTracker: https://github.com/RichyHBM/Monochromatic/issues AutoName: Monochromatic -Summary: Enable the built-in black and white mode Description: |- This app makes use of the built-in black and white device feature to provide a blue-light filtered screen without the use of an overlay screen, to help diff --git a/metadata/uk.co.richyhbm.monochromatic/en-US/summary.txt b/metadata/uk.co.richyhbm.monochromatic/en-US/summary.txt new file mode 100644 index 0000000000..f26bff2e34 --- /dev/null +++ b/metadata/uk.co.richyhbm.monochromatic/en-US/summary.txt @@ -0,0 +1 @@ +Enable the built-in black and white mode diff --git a/metadata/uk.co.yahoo.p1rpp.calendartrigger.yml b/metadata/uk.co.yahoo.p1rpp.calendartrigger.yml index cb311431e1..60306215be 100644 --- a/metadata/uk.co.yahoo.p1rpp.calendartrigger.yml +++ b/metadata/uk.co.yahoo.p1rpp.calendartrigger.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/rparkins999/CalendarTrigger/issues Changelog: https://github.com/rparkins999/CalendarTrigger/releases AutoName: Calendar Trigger -Summary: Trigger actions on calendar events Description: |- Trigger various actions on different types of calendar event, and handle overlapping events wanting different ringer states in a sensible way (the diff --git a/metadata/uk.co.yahoo.p1rpp.calendartrigger/en-US/summary.txt b/metadata/uk.co.yahoo.p1rpp.calendartrigger/en-US/summary.txt new file mode 100644 index 0000000000..50a998b008 --- /dev/null +++ b/metadata/uk.co.yahoo.p1rpp.calendartrigger/en-US/summary.txt @@ -0,0 +1 @@ +Trigger actions on calendar events diff --git a/metadata/uk.org.boddie.android.weatherforecast.yml b/metadata/uk.org.boddie.android.weatherforecast.yml index 90ce114809..078d5e5b93 100644 --- a/metadata/uk.org.boddie.android.weatherforecast.yml +++ b/metadata/uk.org.boddie.android.weatherforecast.yml @@ -3,7 +3,6 @@ Categories: License: GPL-3.0-or-later SourceCode: https://bitbucket.org/dboddie/weather-forecast-android -Summary: View weather forecasts from yr.no Description: |- This application downloads and displays weather forecasts from the yr.no service. diff --git a/metadata/uk.org.boddie.android.weatherforecast/en-US/summary.txt b/metadata/uk.org.boddie.android.weatherforecast/en-US/summary.txt new file mode 100644 index 0000000000..98bca692b4 --- /dev/null +++ b/metadata/uk.org.boddie.android.weatherforecast/en-US/summary.txt @@ -0,0 +1 @@ +View weather forecasts from yr.no diff --git a/metadata/uk.org.crimetalk.yml b/metadata/uk.org.crimetalk.yml index eedf4da3a5..93423120b0 100644 --- a/metadata/uk.org.crimetalk.yml +++ b/metadata/uk.org.crimetalk.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/JohnPersano/CrimeTalk-Reader IssueTracker: https://github.com/JohnPersano/CrimeTalk-Reader/issues AutoName: CrimeTalk -Summary: Read crimetalk.org.uk Description: |- [http://www.crimetalk.org.uk/ CrimeTalk] is a educational publishing venture concerned with crime, criminal justice, social deviance, morality, immorality diff --git a/metadata/uk.org.crimetalk/en-US/summary.txt b/metadata/uk.org.crimetalk/en-US/summary.txt new file mode 100644 index 0000000000..5b8cf019f9 --- /dev/null +++ b/metadata/uk.org.crimetalk/en-US/summary.txt @@ -0,0 +1 @@ +Read crimetalk.org.uk diff --git a/metadata/uk.org.ngo.squeezer.yml b/metadata/uk.org.ngo.squeezer.yml index b6eb320a76..0480badcd0 100644 --- a/metadata/uk.org.ngo.squeezer.yml +++ b/metadata/uk.org.ngo.squeezer.yml @@ -8,7 +8,6 @@ IssueTracker: https://github.com/nikclayton/android-squeezer/issues Changelog: https://github.com/nikclayton/android-squeezer/blob/HEAD/NEWS AutoName: Squeezer -Summary: Squeezebox remote control Description: |- Control your SqueezeCenter ("Slimserver") and Squeezebox (or multiple squeezeboxes) from your Android gadget. diff --git a/metadata/uk.org.ngo.squeezer/en-US/summary.txt b/metadata/uk.org.ngo.squeezer/en-US/summary.txt new file mode 100644 index 0000000000..7d676ba35f --- /dev/null +++ b/metadata/uk.org.ngo.squeezer/en-US/summary.txt @@ -0,0 +1 @@ +Squeezebox remote control diff --git a/metadata/unisiegen.photographers.activity.yml b/metadata/unisiegen.photographers.activity.yml index ecac43276d..18ea83daf9 100644 --- a/metadata/unisiegen.photographers.activity.yml +++ b/metadata/unisiegen.photographers.activity.yml @@ -9,7 +9,6 @@ Changelog: https://bitbucket.org/sdraxler/photographers-notebook/src/tip/Photogr Name: Photographer's Notebook AutoName: Photographer's -Summary: Manage metadata for analog photography Description: |- Photographer's Notebook is an app to store and manage metadata of analogue photos. It is meant to replace the usual paper-based notebooks photographers use diff --git a/metadata/unisiegen.photographers.activity/en-US/summary.txt b/metadata/unisiegen.photographers.activity/en-US/summary.txt new file mode 100644 index 0000000000..b61e136206 --- /dev/null +++ b/metadata/unisiegen.photographers.activity/en-US/summary.txt @@ -0,0 +1 @@ +Manage metadata for analog photography diff --git a/metadata/uobikiemukot.yaft.yml b/metadata/uobikiemukot.yaft.yml index b5709682d5..d50aaa3397 100644 --- a/metadata/uobikiemukot.yaft.yml +++ b/metadata/uobikiemukot.yaft.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/uobikiemukot/yaft-android IssueTracker: https://github.com/uobikiemukot/yaft-android/issues AutoName: yaft -Summary: Simple terminal emulator Description: |- Simple terminal emulator for minimalists. It is based on yaft -- yet another framebuffer terminal. diff --git a/metadata/uobikiemukot.yaft/en-US/summary.txt b/metadata/uobikiemukot.yaft/en-US/summary.txt new file mode 100644 index 0000000000..13792e9b78 --- /dev/null +++ b/metadata/uobikiemukot.yaft/en-US/summary.txt @@ -0,0 +1 @@ +Simple terminal emulator diff --git a/metadata/urbanstew.RehearsalAssistant.yml b/metadata/urbanstew.RehearsalAssistant.yml index 4024cce0a9..5c87be9c36 100644 --- a/metadata/urbanstew.RehearsalAssistant.yml +++ b/metadata/urbanstew.RehearsalAssistant.yml @@ -6,7 +6,6 @@ IssueTracker: https://sourceforge.net/p/rehearsalassist/_list/tickets Donate: https://sourceforge.net/p/rehearsalassist/donate AutoName: Rehearsal Assistant -Summary: A voice/sound recording tool Description: |- A voice / sound recording utility with two modes of operation: diff --git a/metadata/urbanstew.RehearsalAssistant/en-US/summary.txt b/metadata/urbanstew.RehearsalAssistant/en-US/summary.txt new file mode 100644 index 0000000000..13bfa9fd73 --- /dev/null +++ b/metadata/urbanstew.RehearsalAssistant/en-US/summary.txt @@ -0,0 +1 @@ +A voice/sound recording tool diff --git a/metadata/us.achromaticmetaphor.agram.yml b/metadata/us.achromaticmetaphor.agram.yml index fb8091d2c7..8e52d0c5e0 100644 --- a/metadata/us.achromaticmetaphor.agram.yml +++ b/metadata/us.achromaticmetaphor.agram.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/achromaticmetaphor/agram IssueTracker: https://github.com/achromaticmetaphor/agram/issues AutoName: agram -Summary: Anagram lister Description: Lists single-word and multi-word anagrams in English. RepoType: git diff --git a/metadata/us.achromaticmetaphor.agram/en-US/summary.txt b/metadata/us.achromaticmetaphor.agram/en-US/summary.txt new file mode 100644 index 0000000000..44d5c72668 --- /dev/null +++ b/metadata/us.achromaticmetaphor.agram/en-US/summary.txt @@ -0,0 +1 @@ +Anagram lister diff --git a/metadata/us.achromaticmetaphor.imcktg.yml b/metadata/us.achromaticmetaphor.imcktg.yml index 131d95583d..6eb66149ec 100644 --- a/metadata/us.achromaticmetaphor.imcktg.yml +++ b/metadata/us.achromaticmetaphor.imcktg.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/achromaticmetaphor/IMCKTG IssueTracker: https://github.com/achromaticmetaphor/IMCKTG/issues AutoName: IMCKTG -Summary: Ringtone generator Description: Generates Morse code ringtones in WAVE and iMelody formats. RepoType: git diff --git a/metadata/us.achromaticmetaphor.imcktg/en-US/summary.txt b/metadata/us.achromaticmetaphor.imcktg/en-US/summary.txt new file mode 100644 index 0000000000..3d1e301fe3 --- /dev/null +++ b/metadata/us.achromaticmetaphor.imcktg/en-US/summary.txt @@ -0,0 +1 @@ +Ringtone generator diff --git a/metadata/us.bravender.android.dongsa.yml b/metadata/us.bravender.android.dongsa.yml index c7806cc893..5e4acc7f8d 100644 --- a/metadata/us.bravender.android.dongsa.yml +++ b/metadata/us.bravender.android.dongsa.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/dbravender/korean_conjugation IssueTracker: https://github.com/dbravender/korean_conjugation/issues AutoName: Dongsa -Summary: Korean verb conjugation tool Description: Shows Korean verb conjugations for learners of Korean. RepoType: git diff --git a/metadata/us.bravender.android.dongsa/en-US/summary.txt b/metadata/us.bravender.android.dongsa/en-US/summary.txt new file mode 100644 index 0000000000..ea82f679b5 --- /dev/null +++ b/metadata/us.bravender.android.dongsa/en-US/summary.txt @@ -0,0 +1 @@ +Korean verb conjugation tool diff --git a/metadata/us.feras.mdv.demo.yml b/metadata/us.feras.mdv.demo.yml index 5eeff1c96d..380468f2d4 100644 --- a/metadata/us.feras.mdv.demo.yml +++ b/metadata/us.feras.mdv.demo.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/falnatsheh/MarkdownView/issues Changelog: https://github.com/falnatsheh/MarkdownView#changelog AutoName: MarkdownView Demo -Summary: Render markdown text Description: Edit and render text in the markdown format. RepoType: git diff --git a/metadata/us.feras.mdv.demo/en-US/summary.txt b/metadata/us.feras.mdv.demo/en-US/summary.txt new file mode 100644 index 0000000000..8a4aecf4b0 --- /dev/null +++ b/metadata/us.feras.mdv.demo/en-US/summary.txt @@ -0,0 +1 @@ +Render markdown text diff --git a/metadata/us.koller.cameraroll.yml b/metadata/us.koller.cameraroll.yml index a85aeb6569..149bf96bad 100644 --- a/metadata/us.koller.cameraroll.yml +++ b/metadata/us.koller.cameraroll.yml @@ -7,7 +7,6 @@ WebSite: http://lukas.koller.us/ SourceCode: https://github.com/kollerlukas/Camera-Roll-Android-App IssueTracker: https://github.com/kollerlukas/Camera-Roll-Android-App/issues -Summary: Camera Roll Description: |- Camera Roll is the perfect Gallery App to enjoy your photos, gifs and videos. diff --git a/metadata/us.koller.cameraroll/en-US/summary.txt b/metadata/us.koller.cameraroll/en-US/summary.txt new file mode 100644 index 0000000000..a656f64745 --- /dev/null +++ b/metadata/us.koller.cameraroll/en-US/summary.txt @@ -0,0 +1 @@ +Camera Roll diff --git a/metadata/us.lindanrandy.cidrcalculator.yml b/metadata/us.lindanrandy.cidrcalculator.yml index c936f53274..28ae798329 100644 --- a/metadata/us.lindanrandy.cidrcalculator.yml +++ b/metadata/us.lindanrandy.cidrcalculator.yml @@ -7,7 +7,6 @@ IssueTracker: https://github.com/rmceoin/cidrcalculator/issues Changelog: https://github.com/rmceoin/cidrcalculator/blob/HEAD/cidrcalculator/CHANGELOG.txt AutoName: CIDR Calculator -Summary: Internet routing calculation Description: |- CIDR (Classless Inter-Domain Routing) Calculator is a simple IP subnet calculator for network engineers to quickly determine what the address range is diff --git a/metadata/us.lindanrandy.cidrcalculator/en-US/summary.txt b/metadata/us.lindanrandy.cidrcalculator/en-US/summary.txt new file mode 100644 index 0000000000..0bd399f3df --- /dev/null +++ b/metadata/us.lindanrandy.cidrcalculator/en-US/summary.txt @@ -0,0 +1 @@ +Internet routing calculation diff --git a/metadata/us.shandian.giga.yml b/metadata/us.shandian.giga.yml index 6f5c16eb03..0dd6db7748 100644 --- a/metadata/us.shandian.giga.yml +++ b/metadata/us.shandian.giga.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/PaperAirplane-Dev-Team/GigaGet IssueTracker: https://github.com/PaperAirplane-Dev-Team/GigaGet/issues AutoName: GigaGet -Summary: Manage multiple downloads Description: Simple, multi-thread download manager. RepoType: git diff --git a/metadata/us.shandian.giga/en-US/summary.txt b/metadata/us.shandian.giga/en-US/summary.txt new file mode 100644 index 0000000000..8999dafe4d --- /dev/null +++ b/metadata/us.shandian.giga/en-US/summary.txt @@ -0,0 +1 @@ +Manage multiple downloads diff --git a/metadata/ut.ewh.audiometrytest.yml b/metadata/ut.ewh.audiometrytest.yml index afa9544f17..f3317b7b67 100644 --- a/metadata/ut.ewh.audiometrytest.yml +++ b/metadata/ut.ewh.audiometrytest.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/ReeceStevens/ut_ewh_audiometer_2014 IssueTracker: https://github.com/ReeceStevens/ut_ewh_audiometer_2014/issues AutoName: Audiometry Made Easy -Summary: Test your hearing capabilities Description: |- '''Note:''' this app is no longer actively maintained. diff --git a/metadata/ut.ewh.audiometrytest/en-US/summary.txt b/metadata/ut.ewh.audiometrytest/en-US/summary.txt new file mode 100644 index 0000000000..e9c783877d --- /dev/null +++ b/metadata/ut.ewh.audiometrytest/en-US/summary.txt @@ -0,0 +1 @@ +Test your hearing capabilities diff --git a/metadata/vik.linx.stormify.yml b/metadata/vik.linx.stormify.yml index 19d49b3fae..35a50b6268 100644 --- a/metadata/vik.linx.stormify.yml +++ b/metadata/vik.linx.stormify.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/vyaban/Stormify IssueTracker: https://github.com/vyaban/Stormify/issues AutoName: Stormify -Summary: Listen to soothing rainstorms Description: |- Experience a thunderstorm so immersive the rain is almost tangible. It's build with a clean and minimalist design, it helps you relax to the soothing sounds of diff --git a/metadata/vik.linx.stormify/en-US/summary.txt b/metadata/vik.linx.stormify/en-US/summary.txt new file mode 100644 index 0000000000..0584bcc50d --- /dev/null +++ b/metadata/vik.linx.stormify/en-US/summary.txt @@ -0,0 +1 @@ +Listen to soothing rainstorms diff --git a/metadata/vnd.blueararat.kaleidoscope6.yml b/metadata/vnd.blueararat.kaleidoscope6.yml index 6c7917dd42..28dcfa451b 100644 --- a/metadata/vnd.blueararat.kaleidoscope6.yml +++ b/metadata/vnd.blueararat.kaleidoscope6.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/prrt714/Kaleidoscope IssueTracker: https://github.com/prrt714/Kaleidoscope/issues AutoName: Kaleidoscope -Summary: Make symmetrical pictures Description: |- Simulation of a kaleidoscope: a cylinder with mirrors containing loose, colored objects such as beads or pebbles and bits of glass. You can use any image or diff --git a/metadata/vnd.blueararat.kaleidoscope6/en-US/summary.txt b/metadata/vnd.blueararat.kaleidoscope6/en-US/summary.txt new file mode 100644 index 0000000000..bb9578584d --- /dev/null +++ b/metadata/vnd.blueararat.kaleidoscope6/en-US/summary.txt @@ -0,0 +1 @@ +Make symmetrical pictures diff --git a/metadata/vu.de.urpool.quickdroid.yml b/metadata/vu.de.urpool.quickdroid.yml index 6f0258c745..84e45f971e 100644 --- a/metadata/vu.de.urpool.quickdroid.yml +++ b/metadata/vu.de.urpool.quickdroid.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/himmele/quickdroid IssueTracker: https://github.com/himmele/quickdroid/issues AutoName: Quickdroid -Summary: Search through many areas of the system Description: |- Quickly search, find and launch apps, contacts, bookmarks, artists, albums and songs. There is also a plugin interface which enables you to extend it by other diff --git a/metadata/vu.de.urpool.quickdroid/en-US/summary.txt b/metadata/vu.de.urpool.quickdroid/en-US/summary.txt new file mode 100644 index 0000000000..3d50627bd0 --- /dev/null +++ b/metadata/vu.de.urpool.quickdroid/en-US/summary.txt @@ -0,0 +1 @@ +Search through many areas of the system diff --git a/metadata/wb.receiptspro.yml b/metadata/wb.receiptspro.yml index d3c1443ea7..8ecc2ef39f 100644 --- a/metadata/wb.receiptspro.yml +++ b/metadata/wb.receiptspro.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/wbaumann/SmartReceiptsLibrary IssueTracker: https://github.com/wbaumann/SmartReceiptsLibrary/issues AutoName: Smart Receipts Plus -Summary: Receipt scanner/expense reporter Description: |- Turns your phone into a receipt scanner and expense report generator. Just take pictures of your receipts and email yourself a PDF and CSV file. diff --git a/metadata/wb.receiptspro/en-US/summary.txt b/metadata/wb.receiptspro/en-US/summary.txt new file mode 100644 index 0000000000..757d810988 --- /dev/null +++ b/metadata/wb.receiptspro/en-US/summary.txt @@ -0,0 +1 @@ +Receipt scanner/expense reporter diff --git a/metadata/wiseguys.radar.yml b/metadata/wiseguys.radar.yml index d4ccc61f61..6704ab179e 100644 --- a/metadata/wiseguys.radar.yml +++ b/metadata/wiseguys.radar.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/GrahamBlanshard/WiseRadar IssueTracker: https://github.com/GrahamBlanshard/WiseRadar/issues AutoName: WiseRadar -Summary: Canadian satellite weather maps Description: |- View live weather radar imagery from the Canadian government. The weatherdata is available under a non-commercial license. diff --git a/metadata/wiseguys.radar/en-US/summary.txt b/metadata/wiseguys.radar/en-US/summary.txt new file mode 100644 index 0000000000..ca4339c44b --- /dev/null +++ b/metadata/wiseguys.radar/en-US/summary.txt @@ -0,0 +1 @@ +Canadian satellite weather maps diff --git a/metadata/wseemann.media.romote.yml b/metadata/wseemann.media.romote.yml index a7587b9110..2fc4c0bc99 100644 --- a/metadata/wseemann.media.romote.yml +++ b/metadata/wseemann.media.romote.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/wseemann/RoMote IssueTracker: https://github.com/wseemann/RoMote/issues AutoName: RoMote -Summary: Roku remote Description: |- Turn your Android Device into a control center for your Roku Player and Roku TV. diff --git a/metadata/wseemann.media.romote/en-US/summary.txt b/metadata/wseemann.media.romote/en-US/summary.txt new file mode 100644 index 0000000000..e4d131e58b --- /dev/null +++ b/metadata/wseemann.media.romote/en-US/summary.txt @@ -0,0 +1 @@ +Roku remote diff --git a/metadata/x1125io.initdlight.yml b/metadata/x1125io.initdlight.yml index b33ec86292..dc734c5c3c 100644 --- a/metadata/x1125io.initdlight.yml +++ b/metadata/x1125io.initdlight.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/x1125/initd-light IssueTracker: https://github.com/x1125/initd-light/issues AutoName: Init.d Light -Summary: Add missing init.d support Description: |- This app provides simplest functionality for starting scripts on Android startup as root. diff --git a/metadata/x1125io.initdlight/en-US/summary.txt b/metadata/x1125io.initdlight/en-US/summary.txt new file mode 100644 index 0000000000..036b36453d --- /dev/null +++ b/metadata/x1125io.initdlight/en-US/summary.txt @@ -0,0 +1 @@ +Add missing init.d support diff --git a/metadata/x653.bullseye.yml b/metadata/x653.bullseye.yml index 4d5e507286..f53b5b14e0 100644 --- a/metadata/x653.bullseye.yml +++ b/metadata/x653.bullseye.yml @@ -5,7 +5,6 @@ SourceCode: https://gitlab.com/x653/bullseye IssueTracker: https://gitlab.com/x653/bullseye/issues AutoName: Bullseye -Summary: Scoreboard for tournament dart x01 Description: |- Scoreboard for tournament dart x01 diff --git a/metadata/x653.bullseye/en-US/summary.txt b/metadata/x653.bullseye/en-US/summary.txt new file mode 100644 index 0000000000..69c3676cba --- /dev/null +++ b/metadata/x653.bullseye/en-US/summary.txt @@ -0,0 +1 @@ +Scoreboard for tournament dart x01 diff --git a/metadata/xyz.hisname.fireflyiii.yml b/metadata/xyz.hisname.fireflyiii.yml index 3bdca2889d..d579bd563f 100644 --- a/metadata/xyz.hisname.fireflyiii.yml +++ b/metadata/xyz.hisname.fireflyiii.yml @@ -7,7 +7,6 @@ SourceCode: https://github.com/emansih/FireflyMobile IssueTracker: https://github.com/emansih/FireflyMobile/issues AutoName: Firefly III Mobile -Summary: Mobile wrapper for Firefly III Description: Unofficial mobile client for Firefly III, a personal finances manager. RepoType: git diff --git a/metadata/xyz.hisname.fireflyiii/en-US/summary.txt b/metadata/xyz.hisname.fireflyiii/en-US/summary.txt new file mode 100644 index 0000000000..e01fbeb126 --- /dev/null +++ b/metadata/xyz.hisname.fireflyiii/en-US/summary.txt @@ -0,0 +1 @@ +Mobile wrapper for Firefly III diff --git a/metadata/xyz.iridiumion.plucklockex.yml b/metadata/xyz.iridiumion.plucklockex.yml index 2b8b937e1b..43bf68357c 100644 --- a/metadata/xyz.iridiumion.plucklockex.yml +++ b/metadata/xyz.iridiumion.plucklockex.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/0xFireball/PluckLockEx IssueTracker: https://github.com/0xFireball/PluckLockEx/issues AutoName: PluckLockEx -Summary: Lock your phone when snatched Description: |- Lock your phone when snatched. An updated and improved derivative of PluckLock. diff --git a/metadata/xyz.iridiumion.plucklockex/en-US/summary.txt b/metadata/xyz.iridiumion.plucklockex/en-US/summary.txt new file mode 100644 index 0000000000..53c9e0b74f --- /dev/null +++ b/metadata/xyz.iridiumion.plucklockex/en-US/summary.txt @@ -0,0 +1 @@ +Lock your phone when snatched diff --git a/metadata/yellr.net.yellr_android.yml b/metadata/yellr.net.yellr_android.yml index 6472337b64..17ba788701 100644 --- a/metadata/yellr.net.yellr_android.yml +++ b/metadata/yellr.net.yellr_android.yml @@ -6,7 +6,6 @@ IssueTracker: https://github.com/hhroc/yellr-android/issues Changelog: https://github.com/hhroc/yellr-android/releases AutoName: Yellr -Summary: Provide free, open and anonymous feedback Description: |- Allows for anyone from the community to provide, free, open, and anonymous feedback to published assignments, or whatever is on your mind! diff --git a/metadata/yellr.net.yellr_android/en-US/summary.txt b/metadata/yellr.net.yellr_android/en-US/summary.txt new file mode 100644 index 0000000000..916944ec01 --- /dev/null +++ b/metadata/yellr.net.yellr_android/en-US/summary.txt @@ -0,0 +1 @@ +Provide free, open and anonymous feedback diff --git a/metadata/youten.redo.ble.ibeacondetector.yml b/metadata/youten.redo.ble.ibeacondetector.yml index e8bf46c3ef..280d1742b8 100644 --- a/metadata/youten.redo.ble.ibeacondetector.yml +++ b/metadata/youten.redo.ble.ibeacondetector.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/youten/iBeaconDetector IssueTracker: https://github.com/youten/iBeaconDetector/issues AutoName: iBeaconDetector -Summary: Scan for Bluetooth LE peripherals Description: |- Scan Bluetooth Low Energy peripherals and detect iOS iBeacon. Features a sorted beacon list by RSSI and enables you to check wether UUID is correct or not. diff --git a/metadata/youten.redo.ble.ibeacondetector/en-US/summary.txt b/metadata/youten.redo.ble.ibeacondetector/en-US/summary.txt new file mode 100644 index 0000000000..d4edf0a104 --- /dev/null +++ b/metadata/youten.redo.ble.ibeacondetector/en-US/summary.txt @@ -0,0 +1 @@ +Scan for Bluetooth LE peripherals diff --git a/metadata/z4pp3r.flashlightwidget.yml b/metadata/z4pp3r.flashlightwidget.yml index 5e92f1eeb0..96dfc2526b 100644 --- a/metadata/z4pp3r.flashlightwidget.yml +++ b/metadata/z4pp3r.flashlightwidget.yml @@ -6,7 +6,6 @@ SourceCode: https://github.com/fs1995/FlashlightWidget IssueTracker: https://github.com/fs1995/FlashlightWidget/issues AutoName: Flashlight Widget -Summary: Control your LED flash Description: Widget to control your back-LED. RepoType: git diff --git a/metadata/z4pp3r.flashlightwidget/en-US/summary.txt b/metadata/z4pp3r.flashlightwidget/en-US/summary.txt new file mode 100644 index 0000000000..cccc929b04 --- /dev/null +++ b/metadata/z4pp3r.flashlightwidget/en-US/summary.txt @@ -0,0 +1 @@ +Control your LED flash diff --git a/metadata/za.co.lukestonehm.logicaldefence.yml b/metadata/za.co.lukestonehm.logicaldefence.yml index 49f9a617ba..2b324cd74a 100644 --- a/metadata/za.co.lukestonehm.logicaldefence.yml +++ b/metadata/za.co.lukestonehm.logicaldefence.yml @@ -5,7 +5,6 @@ SourceCode: https://github.com/LukeStonehm/LogicalDefence IssueTracker: https://github.com/LukeStonehm/LogicalDefence/issues AutoName: Logical Defence -Summary: Encyclopedia of logical fallacies Description: |- View a list of logical fallacies. Steel yourselves, and begin to defend your mind from the language used against you by the sophists of the world. diff --git a/metadata/za.co.lukestonehm.logicaldefence/en-US/summary.txt b/metadata/za.co.lukestonehm.logicaldefence/en-US/summary.txt new file mode 100644 index 0000000000..94bb2b7f7e --- /dev/null +++ b/metadata/za.co.lukestonehm.logicaldefence/en-US/summary.txt @@ -0,0 +1 @@ +Encyclopedia of logical fallacies diff --git a/metadata/za.co.neilson.alarm.yml b/metadata/za.co.neilson.alarm.yml index 05b75c1df9..18a8f7959f 100644 --- a/metadata/za.co.neilson.alarm.yml +++ b/metadata/za.co.neilson.alarm.yml @@ -4,7 +4,6 @@ License: Apache-2.0 SourceCode: https://github.com/SheldonNeilson/Android-Alarm-Clock AutoName: Alarm Clock -Summary: Disable alarm by solving a math problem Description: |- A simple alarm clock application that requires that you solve a math problem to deactivate the alarm. diff --git a/metadata/za.co.neilson.alarm/en-US/summary.txt b/metadata/za.co.neilson.alarm/en-US/summary.txt new file mode 100644 index 0000000000..01dbb0d5ff --- /dev/null +++ b/metadata/za.co.neilson.alarm/en-US/summary.txt @@ -0,0 +1 @@ +Disable alarm by solving a math problem diff --git a/metadata/zame.GloomyDungeons.opensource.game.yml b/metadata/zame.GloomyDungeons.opensource.game.yml index bdf8f8fc89..446cca0eca 100644 --- a/metadata/zame.GloomyDungeons.opensource.game.yml +++ b/metadata/zame.GloomyDungeons.opensource.game.yml @@ -9,7 +9,6 @@ SourceCode: https://github.com/restorer/gloomy-dungeons-3d IssueTracker: https://github.com/restorer/gloomy-dungeons-3d/issues Name: Gloomy Dungeons -Summary: First-person shooter Description: |- If you loved Doom and Wolfenstein 3D and want to go to back to gaming in the early 90s, Gloomy Dungeons 3D is for you! The game has so many features that you diff --git a/metadata/zame.GloomyDungeons.opensource.game/en-US/summary.txt b/metadata/zame.GloomyDungeons.opensource.game/en-US/summary.txt new file mode 100644 index 0000000000..db3168b588 --- /dev/null +++ b/metadata/zame.GloomyDungeons.opensource.game/en-US/summary.txt @@ -0,0 +1 @@ +First-person shooter